peg_754

peg_754

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(800775, 801329)Protein Length:184aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MRLIFFPKNNNRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHNE
cEEEEEEccccccccccccccccEEEEEHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHcccccHHHHHHHccEEEEEEcHHHHHHHHHHHccHHHHcccccccEEEEEEcccccEEEEEEccccEEcHHHHHHHHHcccHHHHHHHHHcc
cEEEEEcccccccccccccccccEEEHHHHHHHHHHHHHHHHHccccHHcHHHHHHHHHHcccEcccccEEEEEEEcccccccccccEEHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccEEEEEEEEccccEEEEEEEccccccHHHHHHHHHccccEEEEEEEEcc
mrliffpknnnrkgkkkpdgnhdflflEDCYDHAIEMKLQEaeedpnflslQEQQQLEEEkprllrekkpYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKYFENrqtqnydkqgkIGLIFLRSQGKIEIeitldhypispeiafdlehITGITKVVQVIHNE
mrliffpknnnrkgkkkpdgnhDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEeekprllrekkPYIIvvsqedklslqrdsIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKYFenrqtqnydkqgKIGLIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHNE
MRLIFFpknnnrkgkkkpdgnHDFLFLEDCYDHAIEMKLQEAEEDPNFLSlqeqqqleeekprllrekkpYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHNE
MRLIFF*******************FLEDCYDHAIEMKLQ**EE**NFLSLQEQ**LEE**PRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIH******************LIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIH**
MRLIFFPKNNNRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHNE
MRLIFFPKNNNR*GKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHNE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLIFFPKNNNRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHNE
MRLIFFPKNNNRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHNE
MRLIFFPKNNNRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHNE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target184
3151227851226 DNA polymerase III subunit alpha [Candidatus Liberibact 1 3e-65
2221482981179 DNA polymerase III subunit alpha [Agrobacterium vitis S 1 2e-07
2220856001187 DNA polymerase III alpha subunit protein [Agrobacterium 1 5e-07
3252926541166 DNA polymerase III subunit alpha [Agrobacterium sp. H13 1 5e-07
2412041101165 DNA polymerase III subunit alpha [Rhizobium leguminosar 1 6e-07
1106336081172 DNA polymerase III subunit alpha [Mesorhizobium sp. BNC 1 6e-07
1162514891165 DNA polymerase III subunit alpha [Rhizobium leguminosar 1 7e-07
1530097301163 DNA polymerase III subunit alpha [Ochrobactrum anthropi 1 7e-07
179874201178 DNA polymerase III subunit alpha [Brucella melitensis b 1 8e-07
1908913091165 DNA polymerase III protein, alpha subunit [Rhizobium et 1 8e-07
>gi|315122785|ref|YP_004063274.1| DNA polymerase III subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1226 Back     alignment and organism information
 Score =  251 bits (642), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/181 (68%), Positives = 150/181 (82%)

Query: 4    IFFPKNNNRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPR 63
            IFFP  N+   KK  + N DFL LEDCYDH+IE KLQEAEEDPNFLS+QEQ++LE++KP 
Sbjct: 1045 IFFPNYNSSNRKKTSNKNRDFLTLEDCYDHSIERKLQEAEEDPNFLSVQEQRKLEKKKPY 1104

Query: 64   LLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKY 123
            LLREK PYII VSQED +S++RDS+RLL V+SL+ KSMEML SL++YLQD SPL EIHKY
Sbjct: 1105 LLREKNPYIIFVSQEDMVSVKRDSVRLLLVQSLKNKSMEMLVSLKIYLQDHSPLTEIHKY 1164

Query: 124  FENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHN 183
            F+NRQ Q++DK GKI L+F+R Q +IE+EITLD YPIS EI+FDLEHI GI KVV +I +
Sbjct: 1165 FQNRQVQHHDKHGKIDLVFVRLQEEIELEITLDQYPISLEISFDLEHIAGIMKVVPIIRD 1224

Query: 184  E 184
            E
Sbjct: 1225 E 1225


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148298|ref|YP_002549255.1| DNA polymerase III subunit alpha [Agrobacterium vitis S4] Length = 1179 Back     alignment and organism information
>gi|222085600|ref|YP_002544130.1| DNA polymerase III alpha subunit protein [Agrobacterium radiobacter K84] Length = 1187 Back     alignment and organism information
>gi|325292654|ref|YP_004278518.1| DNA polymerase III subunit alpha [Agrobacterium sp. H13-3] Length = 1166 Back     alignment and organism information
>gi|241204110|ref|YP_002975206.1| DNA polymerase III subunit alpha [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1165 Back     alignment and organism information
>gi|110633608|ref|YP_673816.1| DNA polymerase III subunit alpha [Mesorhizobium sp. BNC1] Length = 1172 Back     alignment and organism information
>gi|116251489|ref|YP_767327.1| DNA polymerase III subunit alpha [Rhizobium leguminosarum bv. viciae 3841] Length = 1165 Back     alignment and organism information
>gi|153009730|ref|YP_001370945.1| DNA polymerase III subunit alpha [Ochrobactrum anthropi ATCC 49188] Length = 1163 Back     alignment and organism information
>gi|17987420|ref|NP_540054.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 1 str. 16M] Length = 1178 Back     alignment and organism information
>gi|190891309|ref|YP_001977851.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CIAT 652] Length = 1165 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 184
PRK090741149 consensus 99.81
PRK066371182 consensus 99.65
PRK056731143 dnaE DNA polymerase III subunit alpha; Validated 99.35
PRK087441195 consensus 99.34
PRK089571159 consensus 99.16
PRK078921180 consensus 99.07
PRK07373447 DNA polymerase III subunit alpha; Reviewed 98.98
PRK066581145 consensus 98.87
PRK070121173 consensus 98.86
PRK068261157 dnaE DNA polymerase III DnaE; Reviewed 98.65
PRK085121185 consensus 98.49
PRK069201107 dnaE DNA polymerase III DnaE; Reviewed 98.49
PRK073741171 dnaE DNA polymerase III subunit alpha; Validated 98.48
COG05871139 DnaE DNA polymerase III, alpha subunit [DNA replication 98.26
PRK063261240 consensus 98.08
PRK072791033 dnaE DNA polymerase III DnaE; Reviewed 97.72
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds correspondin 97.87
PRK056721050 dnaE2 error-prone DNA polymerase; Validated 95.7
PRK07135987 dnaE DNA polymerase III DnaE; Validated 92.46
>PRK09074 consensus Back     alignment and domain information
>PRK06637 consensus Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK08744 consensus Back     alignment and domain information
>PRK08957 consensus Back     alignment and domain information
>PRK07892 consensus Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>PRK06658 consensus Back     alignment and domain information
>PRK07012 consensus Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK08512 consensus Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK07374 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>COG0587 DnaE DNA polymerase III, alpha subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06326 consensus Back     alignment and domain information
>PRK07279 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>PRK05672 dnaE2 error-prone DNA polymerase; Validated Back     alignment and domain information
>PRK07135 dnaE DNA polymerase III DnaE; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target184
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 1e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated PIT, 0.003
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 41.1 bits (95), Expect = 1e-04
 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 97  EKKSMEMLD-SLRVYLQDRSPLREIHKYFE 125
           EK++++ L  SL++Y  D +P   I    E
Sbjct: 18  EKQALKKLQASLKLYADDSAPALAIKATME 47


>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target184
2hpi_A1220 DNA polymerase III alpha subunit; POL-beta-like nucleot 98.77
>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
Probab=98.77  E-value=1e-08  Score=73.79  Aligned_cols=137  Identities=16%  Similarity=0.085  Sum_probs=110.1

Q ss_pred             CCCHHCCCCCCCEEEEEEEHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCEE
Q ss_conf             87110028667614898501344333235553102787522105899999878752499828999841001677764269
Q 537021.9.peg.7   10 NNRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIR   89 (184)
Q Consensus        10 ~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~~~~LLe~gkpvii~VsAe~rle~eg~~LR   89 (184)
                      .++|.+++..|+. ++|            +...|+||+++++-|..+++.-+ .+|..|.+++|...-+ +  .++++++
T Consensus      1052 ~~v~~~~TKkG~~-maf------------~tleD~tG~iev~vF~~~y~~~~-~~L~~~~~l~v~G~v~-~--~~~~~i~ 1114 (1220)
T 2hpi_A         1052 EEVVRKPTRSGGM-MAR------------FTLSDETGALEVVVFGRAYEGVS-PKLKEDIPLLVLAEVE-K--GEELRVL 1114 (1220)
T ss_dssp             CCC-------------C------------EEEEETTEEEEEC--------------CTTCEEEEEEEEC--------CEE
T ss_pred             EEEEECCCCCCCE-EEE------------EEEEECCCCEEEEECHHHHHHHH-HHHCCCCEEEEEEEEE-E--CCCEEEE
T ss_conf             7889732799996-999------------99998999889998379999998-8753598799999999-8--9944899


Q ss_pred             EEECCCHHHHHHHHCCCEEEEEE----CCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCEEEEEECCCCCCCHHHH
Q ss_conf             86504158999732011099973----80157899999611221037888713999974898547999668970789899
Q 537021.9.peg.7   90 LLWVESLEKKSMEMLDSLRVYLQ----DRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPEIA  165 (184)
Q Consensus        90 i~~vepLD~aAa~~~kgLRIfVr----D~~pL~sI~s~Le~~~~~~~~G~G~V~Lvli~~~~~~EVEI~Lp~f~VSPqIa  165 (184)
                      +..|.+|+++... .+.+.|.+.    ++..+..+++.|+.     ..|.-+|.|.+..++  .++-+.|+..++++++.
T Consensus      1115 ~~~i~~L~~~~~~-~~~l~i~l~~~~~~~~~l~~l~~il~~-----~~G~~~V~l~~~~~~--~~~~~~l~~~~v~~el~ 1186 (1220)
T 2hpi_A         1115 AQAVWTLEEVLEA-PKALEVEVDHALLDEKGVARLKSLLDE-----HPGSLPVYLRVLGPF--GEALFALREVRVGEEAL 1186 (1220)
T ss_dssp             EEEEEEHHHHTTS-CEEEEEEECSCCCTTTC-CHHHHHHHT-----SEEEEEEEEEEECSS--SEEEEEEEEEEECSTHH
T ss_pred             EEECCCHHHHHCC-CCEEEEEECHHHCCHHHHHHHHHHHHH-----CCCCCEEEEEEECCC--CEEEEEECCCCCCHHHH
T ss_conf             8351559999611-762899943474799999999999973-----969975999998699--45999827812799999


Q ss_pred             HHHHHC
Q ss_conf             987406
Q 537021.9.peg.7  166 FDLEHI  171 (184)
Q Consensus       166 gALKsI  171 (184)
                      ..|++-
T Consensus      1187 ~~L~~~ 1192 (1220)
T 2hpi_A         1187 GLLEAE 1192 (1220)
T ss_dssp             HHHTTT
T ss_pred             HHHHHC
T ss_conf             998748




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target184
2hpi_A_1024-1128105 DNA polymerase III alpha subunit; POL-beta-like nu 97.14
3ebe_A_1-149149 Protein MCM10 homolog; OB-fold, zinc finger, CCCH, 92.27
3f2b_A_1-110110 DNA-directed DNA polymerase III alpha chain; DNA p 92.09
>2hpi_A (A:1024-1128) DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
Probab=97.14  E-value=0.00027  Score=47.31  Aligned_cols=78  Identities=15%  Similarity=0.077  Sum_probs=65.8

Q ss_pred             CCCCCHHCCCCCCCEEEEEEEHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCC
Q ss_conf             68871100286676148985013443332355531027875221058999998787524998289998410016777642
Q 537021.9.peg.7    8 KNNNRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDS   87 (184)
Q Consensus         8 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~~~~LLe~gkpvii~VsAe~rle~eg~~   87 (184)
                      .-.+.+.+++-+|+. ++|            +...|.||++++..|.+..++-+ .+|++|.+++|....+ +  .++.+
T Consensus        27 ~v~~~~~~~tk~G~~-~a~------------~~leD~tg~~e~~~F~~~~~~~~-~~l~~~~~v~i~g~v~-~--~~~~~   89 (105)
T 2hpi_A           27 MVEEVVRKPTRSGGM-MAR------------FTLSDETGALEVVVFGRAYEGVS-PKLKEDIPLLVLAEVE-K--GEELR   89 (105)
T ss_dssp             EECCC-------------C------------EEEEETTEEEEEC--------------CTTCEEEEEEEEC--------C
T ss_pred             EEEEEEECCCCCCCE-EEE------------EEEEECCCCEEEEECHHHHHHHH-HHHCCCCEEEEEEEEE-E--CCCEE
T ss_conf             998999701789997-999------------99998998789998479999998-8851498799999999-7--89528


Q ss_pred             EEEEECCCHHHHHHH
Q ss_conf             698650415899973
Q 537021.9.peg.7   88 IRLLWVESLEKKSME  102 (184)
Q Consensus        88 LRi~~vepLD~aAa~  102 (184)
                      +.+..+.||+++.++
T Consensus        90 l~v~~i~~l~~~~~~  104 (105)
T 2hpi_A           90 VLAQAVWTLEEVLEA  104 (105)
T ss_dssp             EEEEEEEEHHHHTTS
T ss_pred             EEEEECCCHHHHHCC
T ss_conf             999663659999701



>3ebe_A (A:1-149) Protein MCM10 homolog; OB-fold, zinc finger, CCCH, DNA replication, metal-binding, nucleus, zinc, zinc-finger; 2.30A {Xenopus laevis} PDB: 3h15_A Back     alignment and structure
>3f2b_A (A:1-110) DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure