peg_753

peg_753

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(797696, 800797)Protein Length:1033aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:DNA polymerase III alpha subunit (EC 2.7.7.7)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA-replication
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030---
LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP
ccccccccccEEEEccccccHHHHccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccEEEEccccccHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHccccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccEEEEccccHHHccccEEccccccEEEEccHHHHHHcccEEEEEcccccHHHHHHHHHHHHHccccccHHHcccccHHHHHHHHccccEEEEccccHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccEEHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccEEEcccccccccEEEEEccEEEEccHHHccccHHHHHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHcEEEccccHHHHHHHHHHHccccHHHHHHcccccEEEEEEEEEEEEEEccccccEEEEEEEEcccccEEEEEcc
cccccccccccEEEEEcccccccccHccHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHccccccEEEEEEEEcccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccEEEEEccccccHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEccEEEccHHHHHHHHHHEHHHccccccccccccccccHccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHcccHHHHHHHHHHHHHHHHHcccccHEEEHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccHHHHHccHHHHHHHHccHHHHHHHHHHHHHccccccccccccEEEEcccccHccccccccccccccEEcccHHHHHHHccEEHcHHHHHHHHHHHHHHHHHHHccccccHHccccccHHHHHHHHccccEEEEEEccHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHcccccccccccHcHHHHHcccHEHEEEHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHHHcccEEEccccccccEEEEEcccEEEEEEEEEcccccHHHHHHHHHHHccccccHHHHHHHccHHHHHHHHHHHHHHcccHHcccHcHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccccccccHHccccccccccHHHHHHHHHHHHcHEEccccHHHHHHHHHHHccccHHHccccccccEEEEEEEEEEEEEEEcccccEEEEEEEcccccEEEEEEcc
ltqylekspsfvhlqvhssysLLEGALSLNNILDKiaadqqpaiaitdtnnlfSALEFSQKACAAgiqpiigcqldidmqdnlkmtnqgktpfptvpSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIgteglimltggssgpidrafffNSSQVAEKRLLTFKKLFGDRLYVNLqrhrgydryreSQVVQLAYThelplvatnnslflseedyEAHDVLMAVAHSTvvsqkdrprvtpdhylkNRSEMVSIFSDLPEALENTVEIARRCSFILQVhapilprfiEKECDDIQKEEENELRNKAVAGLEVRLAQGAIakgyhaqdyRQRLDFELNVIARMKFSGYFLIVADFIQWAkknnipvgpgrgsgagsvtayaltitdidplRFSLLFErflnpdrmsmpdfdidfCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLcklipndpahpvslqaiaddsrfrearladpsvDRLLEISQKLEGLYRhasthaagivigdrplsqlvpmyrdvrsdlpvtqFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQrgvkvdlslipfddhetyhllttkgtlgifqLESSGMRqalegmqpdCIEDIIALVSlyrpgpidnivvynnrkngkekivsihplidpmlketqgvIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFniqimppsvntpcvdfkvgdnrIYYSLAAIKGVGTTTARHIMEasadkpfdslEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRtnkhenifahekgtfsdkitLEKFSvenssvrfeneqrvlgfyfsghpldvyKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQqkktrkgsrigwvtfsepakeyeanffp
ltqylekspsfvHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNlqrhrgydryRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHstvvsqkdrprvtpdhylKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAkgyhaqdyRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASThaagivigdrplSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKErfisgaskngisKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNiqimppsvntPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEAsadkpfdslEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKhenifahekgtfsdkitLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMvvskqqkktrkgsrigwvtfsepakeyeanffp
LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP
***********VHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQ***************VPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQK*****************************LEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP
LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMV************RIGWVTFSEPAKEYEANFFP
*****EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP
LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP
LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1033
315122785 1226 DNA polymerase III subunit alpha [Candidatus Liberibact 1 0.0
327194832 1165 DNA polymerase III protein, alpha subunit [Rhizobium et 1 0.0
190891309 1165 DNA polymerase III protein, alpha subunit [Rhizobium et 1 0.0
116251489 1165 DNA polymerase III subunit alpha [Rhizobium leguminosar 1 0.0
241204110 1165 DNA polymerase III subunit alpha [Rhizobium leguminosar 1 0.0
86357261 1165 DNA polymerase III subunit alpha [Rhizobium etli CFN 42 1 0.0
209548886 1165 DNA polymerase III subunit alpha [Rhizobium leguminosar 1 0.0
15888619 1167 DNA polymerase III subunit alpha [Agrobacterium tumefac 1 0.0
222085600 1187 DNA polymerase III alpha subunit protein [Agrobacterium 1 0.0
222148298 1179 DNA polymerase III subunit alpha [Agrobacterium vitis S 1 0.0
>gi|315122785|ref|YP_004063274.1| DNA polymerase III subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1226 Back     alignment and organism information
 Score = 1889 bits (4894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 896/1034 (86%), Positives = 969/1034 (93%), Gaps = 1/1034 (0%)

Query: 1    LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQ 60
            L Q +E+SP FVHLQVHSSYSLLEGALSLNNILDK  ADQQPAIAITDTNNLF ALEFSQ
Sbjct: 15   LNQQVERSPGFVHLQVHSSYSLLEGALSLNNILDKAIADQQPAIAITDTNNLFGALEFSQ 74

Query: 61   KACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMY 120
            KAC AGIQPIIGCQ++IDMQD L++T++GK+ FP +PSIVLLVS AEGYQRLIELVSRMY
Sbjct: 75   KACLAGIQPIIGCQIEIDMQDGLEVTHKGKSFFPELPSIVLLVSKAEGYQRLIELVSRMY 134

Query: 121  LLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD 180
            LL+QG +SVRI  SWLQEIGTEGLIMLTGGSSG IDRAF FN+ Q+AEKRLL+FK +FG+
Sbjct: 135  LLNQGHKSVRIYFSWLQEIGTEGLIMLTGGSSGSIDRAFLFNNPQIAEKRLLSFKNIFGN 194

Query: 181  RLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVV 240
            RLYVNLQRHRGYDRYRESQV+QLAY HELPLVATNN+LFLS+EDY+AHDVLMAVAHSTV+
Sbjct: 195  RLYVNLQRHRGYDRYRESQVIQLAYKHELPLVATNNALFLSQEDYDAHDVLMAVAHSTVI 254

Query: 241  SQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKEC 300
            SQ+DRPRVTPDHYLKNR+EM+S+F+DLPEAL+NTVEIARRCSFILQVH PILPRFI+KEC
Sbjct: 255  SQEDRPRVTPDHYLKNRAEMLSMFADLPEALDNTVEIARRCSFILQVHKPILPRFIDKEC 314

Query: 301  DDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIV 360
            DD +K EENELR KA+ GLE RL+QG IAKGY AQDYR+RLDFEL+VIARMKFSGYFLIV
Sbjct: 315  DDFEKIEENELRTKAIEGLETRLSQGIIAKGYSAQDYRKRLDFELDVIARMKFSGYFLIV 374

Query: 361  ADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDI 420
            ADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDI
Sbjct: 375  ADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDI 434

Query: 421  DFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIP 480
            DFCQDRRDEVI+YVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIP
Sbjct: 435  DFCQDRRDEVIQYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIP 494

Query: 481  NDPAHPVSL-QAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            N+PAHPVSL QAIADDSRF+EA L DP VDRLLEIS KLEGLYRHASTHAAGIVIGDRPL
Sbjct: 495  NNPAHPVSLKQAIADDSRFQEAILDDPFVDRLLEISLKLEGLYRHASTHAAGIVIGDRPL 554

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLS 599
            SQL+PMYRDVRSD+PVTQFNMKW+EKAGL+KFDFLGLKTLT+LQKSLD L QRG+KVDLS
Sbjct: 555  SQLIPMYRDVRSDIPVTQFNMKWVEKAGLVKFDFLGLKTLTVLQKSLDLLEQRGIKVDLS 614

Query: 600  LIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV 659
            LIPFDDHETYHLLT KGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPI+NI 
Sbjct: 615  LIPFDDHETYHLLTKKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIENIT 674

Query: 660  VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGK 719
            +YNNRKNGKEKIVSIHPLID +LKETQGVI+YQEQVMQIAQLLSGYSLSEADVLRRAMGK
Sbjct: 675  IYNNRKNGKEKIVSIHPLIDSILKETQGVIVYQEQVMQIAQLLSGYSLSEADVLRRAMGK 734

Query: 720  KIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
            KIKEEMDKQKERF+SGASKNG+S  +AVNIFELLAKFADYGFNKSHAAAYAVISY+TAWM
Sbjct: 735  KIKEEMDKQKERFVSGASKNGLSNIMAVNIFELLAKFADYGFNKSHAAAYAVISYRTAWM 794

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQI+ PSV T CVDF+VG+  IYYSL
Sbjct: 795  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIILPSVQTSCVDFEVGEKCIYYSL 854

Query: 840  AAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM 899
            AAIKGVGT TA HIM   ADKPF+SLEDFCSRVDSK+LNRRVLESL+FAGALDCFGYSR 
Sbjct: 855  AAIKGVGTITAHHIMTVRADKPFESLEDFCSRVDSKQLNRRVLESLIFAGALDCFGYSRE 914

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVL 959
            QL QSLDNIQKYAQW+EKNRTN   NIF  E+G+FS+KI+LE+FSVENSS RFE+E+RVL
Sbjct: 915  QLYQSLDNIQKYAQWIEKNRTNDQANIFVDEEGSFSEKISLEEFSVENSSARFEHERRVL 974

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            GFYFSGHPLDVYK IL+KMGIK YEES+A+++ + IRLA MV+SK+QKKTRKGSRIGWVT
Sbjct: 975  GFYFSGHPLDVYKAILQKMGIKSYEESIASVKESIIRLAVMVMSKEQKKTRKGSRIGWVT 1034

Query: 1020 FSEPAKEYEANFFP 1033
            FSEP KEYE  FFP
Sbjct: 1035 FSEPDKEYEGIFFP 1048


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327194832|gb|EGE61666.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CNPAF512] Length = 1165 Back     alignment and organism information
>gi|190891309|ref|YP_001977851.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CIAT 652] Length = 1165 Back     alignment and organism information
>gi|116251489|ref|YP_767327.1| DNA polymerase III subunit alpha [Rhizobium leguminosarum bv. viciae 3841] Length = 1165 Back     alignment and organism information
>gi|241204110|ref|YP_002975206.1| DNA polymerase III subunit alpha [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1165 Back     alignment and organism information
>gi|86357261|ref|YP_469153.1| DNA polymerase III subunit alpha [Rhizobium etli CFN 42] Length = 1165 Back     alignment and organism information
>gi|209548886|ref|YP_002280803.1| DNA polymerase III subunit alpha [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 1165 Back     alignment and organism information
>gi|15888619|ref|NP_354300.1| DNA polymerase III subunit alpha [Agrobacterium tumefaciens str. C58] Length = 1167 Back     alignment and organism information
>gi|222085600|ref|YP_002544130.1| DNA polymerase III alpha subunit protein [Agrobacterium radiobacter K84] Length = 1187 Back     alignment and organism information
>gi|222148298|ref|YP_002549255.1| DNA polymerase III subunit alpha [Agrobacterium vitis S4] Length = 1179 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1033
PRK05673 1135 PRK05673, dnaE, DNA polymerase III subunit alpha; Valid 0.0
TIGR005941022 TIGR00594, polc, DNA-directed DNA polymerase III (polc) 0.0
PRK06826 1151 PRK06826, dnaE, DNA polymerase III DnaE; Reviewed 0.0
PRK07374 1170 PRK07374, dnaE, DNA polymerase III subunit alpha; Valid 0.0
PRK06920 1107 PRK06920, dnaE, DNA polymerase III DnaE; Reviewed 0.0
COG0587 1139 COG0587, DnaE, DNA polymerase III, alpha subunit [DNA r 0.0
PRK09532874 PRK09532, PRK09532, DNA polymerase III subunit alpha; R 1e-174
PRK07135973 PRK07135, dnaE, DNA polymerase III DnaE; Validated 1e-174
PRK07279 1034 PRK07279, dnaE, DNA polymerase III DnaE; Reviewed 1e-157
PRK056721046 PRK05672, dnaE2, error-prone DNA polymerase; Validated 1e-163
PRK05898971 PRK05898, dnaE, DNA polymerase III DnaE; Validated 1e-149
pfam07733381 pfam07733, DNA_pol3_alpha, Bacterial DNA polymerase III 1e-162
PRK07373 449 PRK07373, PRK07373, DNA polymerase III subunit alpha; R 7e-44
COG21761444 COG2176, PolC, DNA polymerase III, alpha subunit (gram- 7e-31
TIGR014051213 TIGR01405, polC_Gram_pos, DNA polymerase III, alpha cha 1e-29
pfam02811173 pfam02811, PHP, PHP domain 3e-15
smart0048167 smart00481, POLIIIAc, DNA polymerase alpha chain like d 4e-14
PRK004481437 PRK00448, polC, DNA polymerase III PolC; Validated 0.002
PRK004481437 PRK00448, polC, DNA polymerase III PolC; Validated 1e-08
PRK004481437 PRK00448, polC, DNA polymerase III PolC; Validated 3e-06
pfam04919181 pfam04919, DUF655, Protein of unknown function, DUF655 6e-04
COG1491202 COG1491, COG1491, Predicted RNA-binding protein [Transl 0.004
COG21761444 COG2176, PolC, DNA polymerase III, alpha subunit (gram- 0.002
>gnl|CDD|180192 PRK05673, dnaE, DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|161945 TIGR00594, polc, DNA-directed DNA polymerase III (polc) Back     alignment and domain information
>gnl|CDD|180713 PRK06826, dnaE, DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>gnl|CDD|168927 PRK07374, dnaE, DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|180749 PRK06920, dnaE, DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>gnl|CDD|30932 COG0587, DnaE, DNA polymerase III, alpha subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|181933 PRK09532, PRK09532, DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|180857 PRK07135, dnaE, DNA polymerase III DnaE; Validated Back     alignment and domain information
>gnl|CDD|180917 PRK07279, dnaE, DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>gnl|CDD|180191 PRK05672, dnaE2, error-prone DNA polymerase; Validated Back     alignment and domain information
>gnl|CDD|135648 PRK05898, dnaE, DNA polymerase III DnaE; Validated Back     alignment and domain information
>gnl|CDD|149024 pfam07733, DNA_pol3_alpha, Bacterial DNA polymerase III alpha subunit Back     alignment and domain information
>gnl|CDD|180950 PRK07373, PRK07373, DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|32359 COG2176, PolC, DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|162340 TIGR01405, polC_Gram_pos, DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>gnl|CDD|145785 pfam02811, PHP, PHP domain Back     alignment and domain information
>gnl|CDD|128757 smart00481, POLIIIAc, DNA polymerase alpha chain like domain Back     alignment and domain information
>gnl|CDD|179031 PRK00448, polC, DNA polymerase III PolC; Validated Back     alignment and domain information
>gnl|CDD|179031 PRK00448, polC, DNA polymerase III PolC; Validated Back     alignment and domain information
>gnl|CDD|179031 PRK00448, polC, DNA polymerase III PolC; Validated Back     alignment and domain information
>gnl|CDD|113683 pfam04919, DUF655, Protein of unknown function, DUF655 Back     alignment and domain information
>gnl|CDD|31680 COG1491, COG1491, Predicted RNA-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|32359 COG2176, PolC, DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 1033
PRK09074 1149 consensus 100.0
PRK05673 1143 dnaE DNA polymerase III subunit alpha; Validated 100.0
PRK08512 1185 consensus 100.0
PRK06826 1157 dnaE DNA polymerase III DnaE; Reviewed 100.0
PRK07374 1171 dnaE DNA polymerase III subunit alpha; Validated 100.0
PRK07892 1180 consensus 100.0
PRK06658 1145 consensus 100.0
PRK06637 1182 consensus 100.0
PRK07012 1173 consensus 100.0
PRK08957 1159 consensus 100.0
PRK06326 1240 consensus 100.0
PRK08744 1195 consensus 100.0
PRK06920 1107 dnaE DNA polymerase III DnaE; Reviewed 100.0
COG0587 1139 DnaE DNA polymerase III, alpha subunit [DNA replication 100.0
PRK056721050 dnaE2 error-prone DNA polymerase; Validated 100.0
PRK07279 1033 dnaE DNA polymerase III DnaE; Reviewed 100.0
PRK05898971 dnaE DNA polymerase III DnaE; Validated 100.0
PRK07135987 dnaE DNA polymerase III DnaE; Validated 100.0
TIGR005941108 polc DNA polymerase III, alpha subunit; InterPro: IPR00 100.0
PRK09532874 DNA polymerase III subunit alpha; Reviewed 100.0
PRK004481436 polC DNA polymerase III PolC; Validated 100.0
TIGR014051264 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-p 100.0
COG21761444 PolC DNA polymerase III, alpha subunit (gram-positive t 100.0
pfam07733381 DNA_pol3_alpha Bacterial DNA polymerase III alpha subun 100.0
PRK07373 447 DNA polymerase III subunit alpha; Reviewed 100.0
LOAD_php206 consensus 99.98
PRK06361216 hypothetical protein; Provisional 98.84
COG1387237 HIS2 Histidinol phosphatase and related hydrolases of t 98.67
PRK08392215 hypothetical protein; Provisional 98.61
PRK07945335 hypothetical protein; Provisional 98.44
PRK09248246 putative hydrolase; Validated 98.41
COG1379403 PHP family phosphoesterase with a Zn ribbon [General fu 93.07
pfam02811173 PHP PHP domain. The PHP (Polymerase and Histidinol Phos 99.95
smart0048167 POLIIIAc DNA polymerase alpha chain like domain. DNA po 99.61
COG0613258 Predicted metal-dependent phosphoesterases (PHP family) 98.49
PRK00912237 ribonuclease P protein component 3; Provisional 98.03
PRK08123266 histidinol-phosphatase; Reviewed 97.96
pfam12228592 DUF3604 Protein of unknown function (DUF3604). This fam 90.13
PRK08609570 hypothetical protein; Provisional 98.45
PRK07328268 histidinol-phosphatase; Provisional 98.36
PRK05588256 histidinol-phosphatase; Provisional 96.46
PRK04036497 DNA polymerase II small subunit; Validated 95.68
TIGR01856301 hisJ_fam histidinol phosphate phosphatase HisJ family; 94.51
PRK07329246 hypothetical protein; Provisional 94.04
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds correspondin 98.15
pfam0133675 tRNA_anti OB-fold nucleic acid binding domain. This fam 95.56
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds si 93.97
cd04317135 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon re 93.21
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, antico 92.64
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corr 92.49
cd0448392 hOBFC1_like hOBFC1_like: A subfamily of OB folds simila 90.73
TIGR01259124 comE comEA protein; InterPro: IPR004787 The comE locus 96.76
COG1555149 ComEA DNA uptake protein and related DNA-binding protei 96.46
COG1491202 Predicted RNA-binding protein [Translation, ribosomal s 95.92
pfam04919181 DUF655 Protein of unknown function, DUF655. This family 95.45
TIGR0042670 TIGR00426 competence protein ComEA helix-hairpin-helix 95.04
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 92.66
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 90.75
>PRK09074 consensus Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK08512 consensus Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK07374 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK07892 consensus Back     alignment and domain information
>PRK06658 consensus Back     alignment and domain information
>PRK06637 consensus Back     alignment and domain information
>PRK07012 consensus Back     alignment and domain information
>PRK08957 consensus Back     alignment and domain information
>PRK06326 consensus Back     alignment and domain information
>PRK08744 consensus Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>COG0587 DnaE DNA polymerase III, alpha subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05672 dnaE2 error-prone DNA polymerase; Validated Back     alignment and domain information
>PRK07279 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK05898 dnaE DNA polymerase III DnaE; Validated Back     alignment and domain information
>PRK07135 dnaE DNA polymerase III DnaE; Validated Back     alignment and domain information
>TIGR00594 polc DNA polymerase III, alpha subunit; InterPro: IPR004805 All proteins in this family for which functions are known are DNA polymerases Back     alignment and domain information
>PRK09532 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-positive type; InterPro: IPR006308 These are the polypeptide chains of DNA polymerase III Back     alignment and domain information
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam07733 DNA_pol3_alpha Bacterial DNA polymerase III alpha subunit Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>LOAD_php consensus Back     alignment and domain information
>PRK06361 hypothetical protein; Provisional Back     alignment and domain information
>COG1387 HIS2 Histidinol phosphatase and related hydrolases of the PHP family [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>PRK07945 hypothetical protein; Provisional Back     alignment and domain information
>PRK09248 putative hydrolase; Validated Back     alignment and domain information
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only] Back     alignment and domain information
>pfam02811 PHP PHP domain Back     alignment and domain information
>smart00481 POLIIIAc DNA polymerase alpha chain like domain Back     alignment and domain information
>COG0613 Predicted metal-dependent phosphoesterases (PHP family) [General function prediction only] Back     alignment and domain information
>PRK00912 ribonuclease P protein component 3; Provisional Back     alignment and domain information
>PRK08123 histidinol-phosphatase; Reviewed Back     alignment and domain information
>pfam12228 DUF3604 Protein of unknown function (DUF3604) Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>PRK07328 histidinol-phosphatase; Provisional Back     alignment and domain information
>PRK05588 histidinol-phosphatase; Provisional Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>TIGR01856 hisJ_fam histidinol phosphate phosphatase HisJ family; InterPro: IPR010140 This entry represents the histidinol phosphate phosphatase, HisJ of Bacillus subtilis, and related proteins from a number of species within a larger family of phosphatases in the PHP hydrolase family Back     alignment and domain information
>PRK07329 hypothetical protein; Provisional Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>pfam01336 tRNA_anti OB-fold nucleic acid binding domain Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit Back     alignment and domain information
>cd04483 hOBFC1_like hOBFC1_like: A subfamily of OB folds similar to that found in human OB fold containing protein 1 (hOBFC1) Back     alignment and domain information
>TIGR01259 comE comEA protein; InterPro: IPR004787 The comE locus is obligatory for bacterial cell competence - the process of internalizing the exogenous added DNA Back     alignment and domain information
>COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1491 Predicted RNA-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam04919 DUF655 Protein of unknown function, DUF655 Back     alignment and domain information
>TIGR00426 TIGR00426 competence protein ComEA helix-hairpin-helix repeat region; InterPro: IPR004509 This domain is found in competence protein ComEA and closely related proteins from a number of species that exhibit competence for transformation by exongenous DNA, including Streptococcus pneumoniae, Bacillus subtilis, Neisseria meningitidis, and Haemophilus influenzae Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target1033
2hpi_A 1220 Eubacterial And Eukaryotic Replicative Dna Polymera 0.0
3e0d_A 1220 Insights Into The Replisome From The Crystral Struc 0.0
2hnh_A910 Crystal Structure Of The Catalytic Alpha Subunit Of 0.0
2hqa_A917 Crystal Structure Of The Catalytic Alpha Subunit Of 1e-173
3f2b_A1041 Dna Polymerase Polc From Geobacillus Kaustophilus C 2e-84
3e0f_A301 Crystal Structure Of A Putative Metal-Dependent Pho 1e-08
gi|116667773|pdb|2HPI|A Chain A, Eubacterial And Eukaryotic Replicative Dna Polymerases Are Not Homologous: X-Ray Structure Of Dna Polymerase Iii Length = 1220 Back     alignment and structure
 Score =  740 bits (1911), Expect = 0.0,   Method: Composition-based stats.
 Identities = 421/1096 (38%), Positives = 602/1096 (54%), Gaps = 82/1096 (7%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAA----DQQPAIAITDTNNLFSALEFSQ 60
            +     F HL  H+ +SLL+GA  L ++L  +      D  PA+A+TD  NLF A+EF +
Sbjct: 1    MGSKLKFAHLHQHTQFSLLDGAAKLQDLLKWVKETTPED--PALAMTDHGNLFGAVEFYK 58

Query: 61   KACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMY 120
            KA A G++PIIG +  +  +       +GK        + LL     GYQ L+ L SR Y
Sbjct: 59   KATAMGVKPIIGYEAYVAAESRFDR-KRGKGLDGGYFHLTLLAKDFTGYQNLVRLASRAY 117

Query: 121  LLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD 180
            L +   +  RI    L+E   +GLI L+G     I +    +   +AE RL     +FGD
Sbjct: 118  L-EGFYEKPRIDREILRE-HAQGLIALSGCLGAEIPQFILQDRLDLAEARLNEDLSIFGD 175

Query: 181  RLYVNLQRHRGYDRYRESQVV-QLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTV 239
            R ++ +Q H   ++ + +QV+ + A  + L +VATN+  ++ +ED  AH+VL+A+   T 
Sbjct: 176  RFFIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNDGHYVRKEDARAHEVLLAIQSKTT 235

Query: 240  VSQKDRPRVTPDHYLKNRSEMVSIF----SDLPEALENTVEIARRCSFILQVHAPILPRF 295
            +   +R R   D +     E +           E  +NTVEIAR C   L +   ++ R 
Sbjct: 236  LDDPERWRFPCDEFYVKTPEEMRAMLPEAEWGDEPFDNTVEIARMCDVDLPIGDKMVYRI 295

Query: 296  IEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHA--------------------- 334
              +      + E   LR     GL  R         Y                       
Sbjct: 296  -PRFPLPEGRTEAQYLRELTFLGLLRRYPDRITEAFYREVLRLLGTMPPHGDERALAEAL 354

Query: 335  --------------------------QDYRQRLDFELNVIARMKFSGYFLIVADFIQWAK 368
                                      +    R  +EL+VI RM F GYFLIV D+I WA+
Sbjct: 355  ARVEEKAWEELRKRLPPLEGVREWTAEAILHRALYELSVIERMGFPGYFLIVQDYINWAR 414

Query: 369  KNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRD 428
             + + VGPGRGS AGS+ AYA+ IT+IDPLRF LLFERFLNP+R+SMPD D DF    RD
Sbjct: 415  GHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERD 474

Query: 429  EVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVS 488
             VI+YV+ +YG ++VAQI TFGSL +KAAL+DV R   +P+ + + L KLIP     P  
Sbjct: 475  RVIQYVRERYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKP 534

Query: 489  -LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +AI      R     D  + +++E++ +LEGL RHAS HAAG+VI   PL+ LVP+ R
Sbjct: 535  LQEAIQVVPELRAEMEKDERIRQVIEVAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMR 594

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
            D +   PVTQ++M  +E  GL+K DFLGL+TLT L ++   + + +GV++D   +P DD 
Sbjct: 595  D-QEGRPVTQYDMGAVEALGLLKMDFLGLRTLTFLDEARRIVKESKGVELDYDRLPLDDP 653

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +T+ LL+   T G+FQLES GM   + G++P  +EDIIALVSLYRPGP+++I  Y  R +
Sbjct: 654  KTFELLSRGETKGVFQLESGGMTATVRGLKPRRLEDIIALVSLYRPGPMEHIPTYIRRHH 713

Query: 667  GKEKIVS---IHPL--IDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            G+E +      H    + P+L ET G+ +YQEQ+MQIA  ++GYSL EAD+LRRAMGKK 
Sbjct: 714  GQEPVSYAEFPHAEKYLRPILDETYGIPVYQEQIMQIASQVAGYSLGEADLLRRAMGKKR 773

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
             EEM K +ERF+ GA + G+ +  A  +F++L  FA+YGFNKSHAAAY+++SYQTA++K 
Sbjct: 774  VEEMQKHRERFVRGAKERGVPEEEANRLFDMLEAFANYGFNKSHAAAYSLLSYQTAYVKA 833

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEF+AA +++E  + +K+ ++ +DAR   I ++PP VN    DFKV    I + L+A
Sbjct: 834  HYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDFKVVGEEILFGLSA 893

Query: 842  IKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQ 900
            +K VG   AR I+E      PF SL DF  R+  + +N+R LESLV AGALD FG  R +
Sbjct: 894  VKNVGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNKRALESLVKAGALDAFG-DRAR 952

Query: 901  LLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLG 960
            LL SL+ + ++A    +   +    +FA  +     +  L + S  +       E+  LG
Sbjct: 953  LLASLEPLLRWAAETRERGRSGLVGLFAEVE-----EPPLVEASPLDEITMLRYEKEALG 1007

Query: 961  FYFSGHPLDVYKPILRKMGIKGYEES----VATIRGNNIRLAAMVVSKQQKKTRKGSRIG 1016
             Y SGHP+  Y P LR++     EE             + L+ MV    +K TR G  + 
Sbjct: 1008 IYVSGHPVLRY-PGLREVASCTIEELSEFVRELPGKPKVLLSGMVEEVVRKPTRSGGMMA 1066

Query: 1017 WVTFSEPAKEYEANFF 1032
              T S+     E   F
Sbjct: 1067 RFTLSDETGALEVVVF 1082


>gi|206582064|pdb|3E0D|A Chain A, Insights Into The Replisome From The Crystral Structure Of The Ternary Complex Of The Eubacterial Dna Polymerase Iii Alpha-Subunit Length = 1220 Back     alignment and structure
>gi|116667751|pdb|2HNH|A Chain A, Crystal Structure Of The Catalytic Alpha Subunit Of E. Coli Replicative Dna Polymerase Iii Length = 910 Back     alignment and structure
>gi|116667785|pdb|2HQA|A Chain A, Crystal Structure Of The Catalytic Alpha Subunit Of E. Coli Replicative Dna Polymerase Iii Length = 917 Back     alignment and structure
>gi|221046767|pdb|3F2B|A Chain A, Dna Polymerase Polc From Geobacillus Kaustophilus Complex With Dna, Dgtp, Mg And Zn Length = 1041 Back     alignment and structure
>gi|197725318|pdb|3E0F|A Chain A, Crystal Structure Of A Putative Metal-Dependent Phosphoesterase (Bad_1165) From Bifidobacterium Adolescentis Atcc At 2.40 A Resolution Length = 301 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1033
2hnh_A910 DNA polymerase III alpha subunit; DNA replication, nucl 0.0
3f2b_A1041 DNA-directed DNA polymerase III alpha chain; DNA polyme 1e-175
2hpi_A 1220 DNA polymerase III alpha subunit; POL-beta-like nucleot 0.0
3e38_A343 Two-domain protein containing predicted PHP-like metal- 1e-20
3e0f_A301 Putative metal-dependent phosphoesterase; YP_910028.1, 1e-08
3o0f_A301 Putative metal-dependent phosphoesterase; structural ge 2e-07
1m65_A245 Hypothetical protein YCDX; structural genomics, beta-al 6e-06
3dcp_A283 Histidinol-phosphatase; HISK, histidine biosynthesis, N 0.003
>2hnh_A DNA polymerase III alpha subunit; DNA replication, nucleotidyltransferase, POL beta, PHP; HET: DNA; 2.30A {Escherichia coli} PDB: 2hqa_A* Length = 910 Back     alignment and structure
 Score =  797 bits (2059), Expect = 0.0
 Identities = 403/924 (43%), Positives = 572/924 (61%), Gaps = 36/924 (3%)

Query: 8   SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            P FVHL+VHS YS+++G      ++ K AA   PA+AITD  NL   ++F      AGI
Sbjct: 3   EPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFTNLCGLVKFYGAGHGAGI 62

Query: 68  QPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
           +PI+G   ++          Q       +  + +L +   GYQ L  L+S+ Y    G  
Sbjct: 63  KPIVGADFNV----------QCDLLGDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAA 112

Query: 128 SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQ 187
              I   WL E+  EGLI+L+GG  G + R+    +S + ++ +  +++ F DR ++ L 
Sbjct: 113 GPIIDRDWLIEL-NEGLILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFPDRYFLELI 171

Query: 188 RH-RGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
           R  R  +       V+LA    LP+VATN+  F+   D++AH++ +A+     +    RP
Sbjct: 172 RTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDGFTLDDPKRP 231

Query: 247 RV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
           R  +P  Y+++  EM  +F+D+PEAL NTVEIA+RC+  +++    LP+F   +      
Sbjct: 232 RNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQFPTGDMSTED- 290

Query: 306 EEENELRNKAVAGLEVRLAQGAIAKGYHA---QDYRQRLDFELNVIARMKFSGYFLIVAD 362
                L  +A  GLE RLA     +        +Y +RL+ EL VI +M F GYFLIV +
Sbjct: 291 ----YLVKRAKEGLEERLAFLFPDEEERLKRRPEYDERLETELQVINQMGFPGYFLIVME 346

Query: 363 FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
           FIQW+K N +PVGPGRGSGAGS+ AYAL ITD+DPL F LLFERFLNP+R+SMPDFD+DF
Sbjct: 347 FIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDF 406

Query: 423 CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
           C ++RD+VI +V + YG + V+QIITFG++ AKA +RDVGR L  PY  VDR+ KLIP D
Sbjct: 407 CMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPD 466

Query: 483 PAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
           P   ++ +A   + +  E   AD  V  L+++++KLEG+ R+A  HA G+VI    ++  
Sbjct: 467 PGMTLA-KAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDF 525

Query: 543 VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGV-----KVD 597
            P+Y D     PVTQF+   +E AGL+KFDFLGL+TLT++  +L+ + +R        +D
Sbjct: 526 APLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRRAKNGEPPLD 585

Query: 598 LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
           ++ IP DD +++ +L    T  +FQLES GM+  ++ +QPDC ED+IALV+L+RPGP+ +
Sbjct: 586 IAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQS 645

Query: 658 IVVYNNR--KNGKEKIVSI-----HPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEA 710
            +V N    K+G+E+I        H  + P+L+ T G+I+YQEQVMQIAQ+LSGY+L  A
Sbjct: 646 GMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYTLGGA 705

Query: 711 DVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYA 770
           D+LRRAMGKK  EEM KQ+  F  GA KNGI+  +A+ IF+L+ KFA YGFNKSH+AAYA
Sbjct: 706 DMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAGYGFNKSHSAAYA 765

Query: 771 VISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKV 830
           ++SYQT W+K HYP EF+AA MT +MDN EK+     +  +  ++I+PP +N+    F V
Sbjct: 766 LVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHV 825

Query: 831 -GDNRIYYSLAAIKGVGTTTARHIMEA-SADKPFDSLEDFCSRVDSKKLNRRVLESLVFA 888
             D  I Y + AIKGVG      I+EA +    F  L D C+R D+KKLNRRVLE L+ +
Sbjct: 826 NDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDTKKLNRRVLEKLIMS 885

Query: 889 GALDCFGYSRMQLLQSLDNIQKYA 912
           GA D  G  R  L+ SL +  K A
Sbjct: 886 GAFDRLGPHRAALMNSLGDALKAA 909


>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Length = 1041 Back     alignment and structure
>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Length = 1220 Back     alignment and structure
>3e38_A Two-domain protein containing predicted PHP-like metal-dependent phosphoesterase; YP_001300751.1, structural genomics; 2.20A {Bacteroides vulgatus atcc 8482} Length = 343 Back     alignment and structure
>3e0f_A Putative metal-dependent phosphoesterase; YP_910028.1, structural genomics, joint center for structural genomics, JCSG; 2.40A {Bifidobacterium adolescentis ATCC15703} Length = 301 Back     alignment and structure
>3o0f_A Putative metal-dependent phosphoesterase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: AMP; 1.94A {Bifidobacterium adolescentis} PDB: 3e0f_A* Length = 301 Back     alignment and structure
>1m65_A Hypothetical protein YCDX; structural genomics, beta-alpha-barrel, zinc, metallo- enzyme, structure 2 function project, S2F, unknown function; 1.57A {Escherichia coli} SCOP: c.6.3.1 PDB: 1m68_A 1pb0_A Length = 245 Back     alignment and structure
>3dcp_A Histidinol-phosphatase; HISK, histidine biosynthesis, NESG, LMR141, structural genomics, PSI-2, protein structure initiative; 2.10A {Listeria monocytogenes str} Length = 283 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target1033
2hpi_A 1220 DNA polymerase III alpha subunit; POL-beta-like nucleot 100.0
2hnh_A910 DNA polymerase III alpha subunit; DNA replication, nucl 100.0
3f2b_A1041 DNA-directed DNA polymerase III alpha chain; DNA polyme 100.0
3e38_A343 Two-domain protein containing predicted PHP-like depend 99.78
3o0f_A301 Putative metal-dependent phosphoesterase; structural ge 99.74
1m65_A245 Hypothetical protein YCDX; structural genomics, beta-al 99.43
3dcp_A283 Histidinol-phosphatase; HISK, histidine biosynthesis, N 99.42
2yxo_A267 Histidinol phosphatase; metal-dependent, hydrolase; 1.6 99.36
2anu_A255 Hypothetical protein TM0559; predicted metal-dependent 98.81
2wje_A247 CPS4B, tyrosine-protein phosphatase CPSB; capsule bioge 99.15
2w9m_A578 Polymerase X; SAXS, DNA repair, DNA polymerase, DNA rep 98.71
2edu_A98 Kinesin-like protein KIF22; kinesin-like DNA binding do 96.46
2i5h_A205 Hypothetical protein AF1531; PFAM:DUF655, PSI-2, struct 95.57
1s5l_U134 Photosystem II 12 kDa extrinsic protein; photosynthesis 93.59
3bz1_U104 Photosystem II 12 kDa extrinsic protein; electron trans 93.32
2duy_A75 Competence protein comea-related protein; helix-hairpin 91.16
2k50_A115 Replication factor A related protein; uncharacterized p 95.13
3e0e_A97 Replication protein A; structural genomics, PSI-2, prot 93.44
3dm3_A105 Replication factor A; probably plays AN essential for r 93.29
3kf6_A159 Protein STN1; OB fold, chromosomal protein, DNA-binding 90.88
3i7f_A548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding 93.44
1e1o_A504 Lysyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetas 92.75
3a74_A493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligas 91.48
3bju_A521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- 90.97
3m4p_A456 Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoac 92.86
>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=2408.03  Aligned_cols=1014  Identities=42%  Similarity=0.681  Sum_probs=955.6

Q ss_pred             CCCCCCCHHHHHHCHHHHHHHCCCHHHHHHHHHHCCC--CEEEEECCCHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCC
Q ss_conf             6689881334331444764432998999999997899--88998116517749999999997699638999999854766
Q 537021.9.peg.7    5 LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQ--PAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDN   82 (1033)
Q Consensus         5 ~~~~~~FvhLh~hS~ySlldg~~~~e~LV~~A~~~G~--~AiAITD~~nl~Gav~F~~ackk~gIKPIiG~E~~v~~~~~   82 (1033)
                      |.+..+||||||||+||+|||+++|++||++|+++||  |||||||||||||+++|+++|+++|||||+|||+|+.++..
T Consensus         1 m~~~m~FvhLhvhS~YSlLdg~~~i~~Lv~~Ake~G~~~pAvAiTDh~nl~Gav~F~~~akk~gIKPIiG~E~~v~~~~~   80 (1220)
T 2hpi_A            1 MGSKLKFAHLHQHTQFSLLDGAAKLQDLLKWVKETTPEDPALAMTDHGNLFGAVEFYKKATAMGVKPIIGYEAYVAAESR   80 (1220)
T ss_dssp             ----CCCCCCSBCCTTSTTTCCCCHHHHHHHHHHHCCSSCEEEEEEETCCTTHHHHHHHHHTTTCEEEEEEEEEEESSCT
T ss_pred             CCCCCCCHHHCCCCCCCHHCCCCCHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCC
T ss_conf             99988524114477471314046999999999976988988999608888779999999997699848878999658641


Q ss_pred             CCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCEEEECCCCCCHHHHHHHCC
Q ss_conf             43344565666677539999569689999999998997324877874007899986348988998197679678888779
Q 537021.9.peg.7   83 LKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFN  162 (1033)
Q Consensus        83 ~~~~~~~~~~~~~~~~lvlLAkN~~Gy~nL~kL~S~a~~~~~~~~~p~i~~~~L~e~~~egLIvlsg~~~g~i~~~l~~~  162 (1033)
                      .++.. +.......+|++|||||++||+|||+|+|.+|++ +++++||+++++|.+ |++||||+|||..|+++++++.+
T Consensus        81 ~~~~~-~~~~~~~~~hlvLLAkN~~GY~NL~kL~S~a~~~-g~~~~Pri~~~~L~~-~~egLI~lsgc~~g~i~~~l~~~  157 (1220)
T 2hpi_A           81 FDRKR-GKGLDGGYFHLTLLAKDFTGYQNLVRLASRAYLE-GFYEKPRIDREILRE-HAQGLIALSGCLGAEIPQFILQD  157 (1220)
T ss_dssp             TCCCC-C-----CEEEEEEEECSHHHHHHHHHHHHHHHHT-CBSSSBEECHHHHHH-TCTTEEEECCSTTBHHHHHHHTT
T ss_pred             CCCCC-CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHH-CCCCCCCCCHHHHHH-CCCCCEEECCCCCCHHHHHHHCC
T ss_conf             23334-5667787201899978999999999999999970-787888778999985-07991996487436688998679


Q ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEECCCHHHH-HHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             97899999999987659868999943991158-99999999999818989980883007878899998766884698576
Q 537021.9.peg.7  163 SSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVS  241 (1033)
Q Consensus       163 ~~~~a~~~l~~l~~~Fgd~~ylEl~~~~~~e~-~~~~~l~~lA~~~~iPlVaTndv~Y~~~~D~~~h~iL~aI~~~~~l~  241 (1033)
                      +.+.|++.+.+|+++||+|||+|||+|+..++ .++..++++|+++++|+||||||||++++|+.+|++|+||++|++++
T Consensus       158 ~~~~a~~~l~~~~~iFgd~~YlEiq~~~~~~~~~~n~~li~lA~~~~iplVATndvhYl~~eD~~~hdvL~~I~~g~~l~  237 (1220)
T 2hpi_A          158 RLDLAEARLNEDLSIFGDRFFIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNDGHYVRKEDARAHEVLLAIQSKTTLD  237 (1220)
T ss_dssp             CHHHHHHHHHHHHHHHGGGEEEEECCSSCHHHHHHHHHHHHHHHHTTCCEEECCCBSBSSGGGHHHHHHHHHHHTTCCSS
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             98999999999998648968999951898689999999999999849999997987407761699999999985799326


Q ss_pred             CCCCCCC-CCCCCCCCHHHHHHHCCHHH---HHHHHHHHHHHHHHHHHHHH---HCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             5310024-53432343478875122035---89987886411100013322---10234555756887768988999876
Q 537021.9.peg.7  242 QKDRPRV-TPDHYLKNRSEMVSIFSDLP---EALENTVEIARRCSFILQVH---APILPRFIEKECDDIQKEEENELRNK  314 (1033)
Q Consensus       242 ~~~~~~~-~~~~yLks~eEM~~~f~~~p---eAi~NT~~IAe~c~~~l~~~---~~~lP~f~~p~~~~~~~~~~~~Lr~l  314 (1033)
                      ++++.++ +.++||||++||.++|+++|   +|++||.+||++|+++++..   .++||+||+|++    .++++||+++
T Consensus       238 d~~r~~~~~~e~ylKS~eEM~~lf~~~p~~~eal~NT~~IA~~c~~~l~~~~~~~~~lP~f~~p~g----~t~~~yLr~l  313 (1220)
T 2hpi_A          238 DPERWRFPCDEFYVKTPEEMRAMLPEAEWGDEPFDNTVEIARMCDVDLPIGDKMVYRIPRFPLPEG----RTEAQYLREL  313 (1220)
T ss_dssp             CSSCCCCSSSCCBCCCHHHHHHHSCHHHHCSHHHHHHHHHHHTCCCCCCCTTSCCCBCCCCCC--C----CCHHHHHHHH
T ss_pred             CCCCCCCCCHHHCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHEEECCCCCCCCCCCCCCCCCC----CCHHHHHHHH
T ss_conf             463334786452379899997643345014678899999987531231136544455898889999----8989999999


Q ss_pred             HHHHHHHCCCCCCC-----------------------------------------------CCCCCHHHHHHHHHHHHHH
Q ss_conf             54103420124643-----------------------------------------------2457838999998877898
Q 537021.9.peg.7  315 AVAGLEVRLAQGAI-----------------------------------------------AKGYHAQDYRQRLDFELNV  347 (1033)
Q Consensus       315 ~~~Gl~~R~~~~~~-----------------------------------------------~~~~~~~~y~~RLe~EL~v  347 (1033)
                      |++||++||++...                                               .++...++|.+||+|||+|
T Consensus       314 ~~~Gl~~Ry~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Rl~~EL~i  393 (1220)
T 2hpi_A          314 TFLGLLRRYPDRITEAFYREVLRLLGTMPPHGDERALAEALARVEEKAWEELRKRLPPLEGVREWTAEAILHRALYELSV  393 (1220)
T ss_dssp             HHHHHHHHCTTTSCHHHHHHHHTTC-------CHHHHHHHHHHCCHHHHTTTTTC--------CCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99689986476651667777766423566542135567788888777788876430332243321048899999999999


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHCCCHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             98606305578889999985104764334444204667765544037563332310567621001457875333656878
Q 537021.9.peg.7  348 IARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR  427 (1033)
Q Consensus       348 I~~~gf~~YFLiV~Div~~ak~~gI~vGpGRGSAagSLVaY~LgIT~VDPi~~~LlFERFLnp~R~~~PDIDiDf~~~~R  427 (1033)
                      |.+|||++|||||||+|+|||++||+||||||||||||||||||||+||||+|||||||||||+|.+||||||||++++|
T Consensus       394 I~~~gf~~YFLiv~d~v~~ak~~~i~vGpGRGSaagSLVaY~LgIT~vDPi~~~LlFERFLnpeR~~~PDIDiDf~~~~R  473 (1220)
T 2hpi_A          394 IERMGFPGYFLIVQDYINWARGHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRER  473 (1220)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHHTTTCCBCSCCGGGGGCHHHHHTTSCCSCTTTTTCCHHHHSCTTSCCCCCCEEEEETTTH
T ss_pred             HHHCCCCCEEEEHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCHHHH
T ss_conf             98179983687613788998728916689999877882340257877684335866788556013666674557774658


Q ss_pred             HHHHHHHHHHCCCCCEEECCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCH-HHHHCCHHHHHHHHCCC
Q ss_conf             99999998303802155422077877889999999752799889886543101458982443-44522988788643074
Q 537021.9.peg.7  428 DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSL-QAIADDSRFREARLADP  506 (1033)
Q Consensus       428 ~~vi~y~~~kyG~~~va~i~t~~t~~~k~aird~~r~~g~~~~~~~~~~~~i~~~~~~~~~~-~~~~~~~~~~~~~~~~~  506 (1033)
                      ++||+||.+|||.++||||+||+|+++|+|+|||||++|+|+.++|+++|+||...+...++ ++++..++|++....++
T Consensus       474 ~~vi~Yv~~kyG~~~Va~I~Tf~t~~~k~airdv~r~~g~~~~~~~~i~k~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~  553 (1220)
T 2hpi_A          474 DRVIQYVRERYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKPLQEAIQVVPELRAEMEKDE  553 (1220)
T ss_dssp             HHHHHHHHHHHCTTTEEEEEEEEECCHHHHHHHHHHHTTCCHHHHHHHHTTSCBSSSSBCCTTTC-----CCTTHHHHCH
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHCHHHHHHHHCCH
T ss_conf             99999999871753112200000067889999999983733888888764078666775315667653789997764399


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHEECCCCCCCCCEEEEEECHHHHHHCCCHHHHHHHCCHHHHHHHH
Q ss_conf             20268898720112210024474403352566666200123676886688510213343112321356541789999999
Q 537021.9.peg.7  507 SVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSL  586 (1033)
Q Consensus       507 ~~~~~~~~a~~leg~~r~~~~Ha~Gvvi~~~~l~~~~p~~~~~~~~~~~~q~d~~~~e~~gl~K~D~Lgl~~L~~i~~~~  586 (1033)
                      .+++++++|.+|||++||+|+||||||||++||++++|++++. ++.++|||||+++|++||+|||||||+|||+|++++
T Consensus       554 ~~~~l~~~A~~leG~~r~~g~Ha~Gvvi~~~~l~~~~P~~~~~-~~~~~tq~d~~~~e~~gLlK~D~LGl~~Ltii~~~~  632 (1220)
T 2hpi_A          554 RIRQVIEVAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMRDQ-EGRPVTQYDMGAVEALGLLKMDFLGLRTLTFLDEAR  632 (1220)
T ss_dssp             HHHHHHHHHHHSTTCEEEEEEEEEEEEECSSCGGGTSCEEECT-TCCEEESSCHHHHHTTTBEEEEEEEEHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCCEEEEEECC-CCCCEEEECHHHHHHCCCHHHHHHCCCCHHHHHHHH
T ss_conf             9999999999824976546767887998568865434047868-998247620002754687454665146478999999


Q ss_pred             HHHHH-HCCCCCCCCCCCCHHHHHHHHHCCCCCHHHHCCCHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             98874-02543433234435889987620141012211453478888771740488887665411411342003688850
Q 537021.9.peg.7  587 DFLAQ-RGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK  665 (1033)
Q Consensus       587 ~~i~~-~~~~~d~~~ip~~D~~~~~l~~~g~t~GvFQ~es~~~~~~l~~~~p~~~~dl~~~~al~RPGp~~~~~~yi~rk  665 (1033)
                      ++|++ +|.++|+++||+||++||+||++|+|.||||+||+||++++++++|++|+||++++||||||||++++.|+.||
T Consensus       633 ~~i~~~~~~~~~~~~ip~dD~~~~~l~~~g~t~GifQ~es~g~~~~l~~~~p~~~~dl~a~~al~RPGp~~~i~~~~~~k  712 (1220)
T 2hpi_A          633 RIVKESKGVELDYDRLPLDDPKTFELLSRGETKGVFQLESGGMTATVRGLKPRRLEDIIALVSLYRPGPMEHIPTYIRRH  712 (1220)
T ss_dssp             HHHHHHHCCCCCGGGCCTTCHHHHHHHHTTCCTTCTTCCSHHHHHHHHHHCCCSHHHHHHHHHHCSTTGGGHHHHHHHHH
T ss_pred             HHHHHHHCCCCCHHCCCCCCHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHH
T ss_conf             99987038976631189876999999847521786755464066687518998788999998651887742024788885


Q ss_pred             CCCCCCCC-----CCHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             46578502-----6966733410335530012568988788632684130788976201211016778789999986249
Q 537021.9.peg.7  666 NGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFISGASKNG  740 (1033)
Q Consensus       666 ~g~e~~~~-----~hp~l~~iL~~T~Gv~vyQEQvm~ia~~~ag~~~~ead~lRra~~kk~~~~~~~~~~~f~~g~~~~g  740 (1033)
                      ||+++++|     +||.|++||++||||||||||||+|++.+||||++|||.||||||||+.++|++++++|++||.++|
T Consensus       713 ~g~~~~~y~~~~~~~~~l~~il~~TyGvivyQEqvM~i~~~~agfs~~eaD~lRram~KK~~~~m~~~~~~f~~g~~~~g  792 (1220)
T 2hpi_A          713 HGQEPVSYAEFPHAEKYLRPILDETYGIPVYQEQIMQIASQVAGYSLGEADLLRRAMGKKRVEEMQKHRERFVRGAKERG  792 (1220)
T ss_dssp             TTCSCCCCTTSTTTHHHHHHHHGGGTTCCCBHHHHHHHHHHHSCCCHHHHHHHHHHHHHTCTTTHHHHHHHHHHHHHHHS
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCC
T ss_conf             48777655567753588998874226830129999989999738986778899872066878999999877505651248


Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             99999999999999750001331014788899999999997302666777510023542025899988886368503552
Q 537021.9.peg.7  741 ISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPS  820 (1033)
Q Consensus       741 ~~~~~a~~i~~~i~~f~~Y~FnksHa~aya~~~y~~aylK~~yP~eF~aa~L~~~~~~~~~~~~~i~e~~~~gi~vl~Pd  820 (1033)
                      ++++.|++||++|++||+||||||||+|||++||||||||+|||+|||||+||++++++++++.|++|||++||+|+|||
T Consensus       793 ~~~~~a~~i~~~i~~fa~YgFnKSHa~aYa~iayqtAylK~~yP~eF~aa~l~~~~~~~~~~~~~i~e~~~~gi~v~~Pd  872 (1220)
T 2hpi_A          793 VPEEEANRLFDMLEAFANYGFNKSHAAAYSLLSYQTAYVKAHYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPD  872 (1220)
T ss_dssp             CCSHHHHHHHHHHHHHTTSCBCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHTTTCHHHHHHHHHHHHTTTCCEECCC
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCE
T ss_conf             77999999999999987416684069999999999999988499999999812788984478999999987324656982


Q ss_pred             CCCCCEEEEECCCEEEEEHHHHCCCCHHHHHHHHHHH-HCCCCCCHHHHHHHCCCCCCCHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             3342100353198698502685896989999999998-379999978999734824799899998886767234790389
Q 537021.9.peg.7  821 VNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM  899 (1033)
Q Consensus       821 IN~S~~~f~~~~~~Ir~Gl~~Ikgvg~~~~~~Ive~r-~~g~f~sl~df~~rv~~~~~nk~~le~Li~aGAfD~~~~~R~  899 (1033)
                      ||+|.++|++++++||+||++|||||+++++.|+++| ++|||+|++||+.|++.+.+||+++|+||+|||||+|| ||+
T Consensus       873 iN~S~~~f~~~~~~i~~gL~aIKgvg~~~~~~Ii~eR~~~G~f~sl~Df~~Rvd~~~~nk~~lE~LIkaGAFD~~g-~R~  951 (1220)
T 2hpi_A          873 VNRSGFDFKVVGEEILFGLSAVKNVGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNKRALESLVKAGALDAFG-DRA  951 (1220)
T ss_dssp             TTTCCSSCEEETTEEECCSTTSSSCCHHHHHHHHHHHHHSCSCCSHHHHHHHSCTTTSCHHHHHHHHHHTTTGGGS-CHH
T ss_pred             ECCCCCCCEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCC-CHH
T ss_conf             0124564442486345777761585067799999999856998747789988520469999999999838755534-499


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCEEECCCCHHHHHHHHHHC-
Q ss_conf             9999899999999988654312777866665555655776668999988899985788726211638558999999874-
Q 537021.9.peg.7  900 QLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKM-  978 (1033)
Q Consensus       900 ~ll~~i~~~~~~~~~~~~~~~~~q~~LF~~~~~~~~~~~~~~~~~~~~~~e~l~~E~e~LGf~lS~HPl~~~~~~l~~~-  978 (1033)
                      +||++++.+++++....+++..+|.+||+...     .+.+++.++|+..|++++|+|+||||+|+|||+.|+. +... 
T Consensus       952 ~ll~~l~~~l~~~~~~~~~~~~~q~~LF~~~~-----~~~~~~~~~~~~~e~L~~Eke~LGfylS~HPL~~y~~-l~~~~ 1025 (1220)
T 2hpi_A          952 RLLASLEPLLRWAAETRERGRSGLVGLFAEVE-----EPPLVEASPLDEITMLRYEKEALGIYVSGHPVLRYPG-LREVA 1025 (1220)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTCCCSSSSCCC-----CCCCCCCCCCCHHHHHHHHHHHHSSCCSCCGGGGCTH-HHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC-----CCCCCCCCCCCHHHHHHHHHHHEEEECCCCCCCHHHH-HHHHH
T ss_conf             99981999999999986521036878667777-----7667789998999999999973334426683100898-99773


Q ss_pred             --CCCCHHHH-HCCCCCCEEEEEEEEEEEEEECCCCCCEEEEEEEECCCCEEEEEECC
Q ss_conf             --89768898-50558988999999961121015888769999998497049999539
Q 537021.9.peg.7  979 --GIKGYEES-VATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033 (1033)
Q Consensus       979 --~~~~~~~~-~~~~~g~~v~iaG~V~~i~~~~TKkG~~mafltleD~~g~~e~~iFP 1033 (1033)
                        .+..+.+. .+...+++|+++|+|+++|+++||+|++|+|+|+||++|.+|++|||
T Consensus      1026 ~~~~~~l~~~~~~~~~~~~v~vaG~I~~v~~~~TKkG~~maf~tleD~tG~iev~vF~ 1083 (1220)
T 2hpi_A         1026 SCTIEELSEFVRELPGKPKVLLSGMVEEVVRKPTRSGGMMARFTLSDETGALEVVVFG 1083 (1220)
T ss_dssp             SSCTTTHHHHHSSSSSSCEEEEEEEECCC------------CEEEEETTEEEEEC---
T ss_pred             CCCHHHHHHHHHHCCCCCEEEEEEEEEEEEECCCCCCCEEEEEEEEECCCCEEEEECH
T ss_conf             4887889999972789988999999978897327999969999999899988999837



>2hnh_A DNA polymerase III alpha subunit; DNA replication, nucleotidyltransferase, POL beta, PHP; HET: DNA; 2.30A {Escherichia coli} PDB: 2hqa_A* Back     alignment and structure
>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure