peg_888

peg_888

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(958632, 959285)Protein Length:217aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:tRNA delta(2)-isopentenylpyrophosphate transferase (EC 2.5.1.8)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA processing
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF
cHHHHHHHHHcccccEEEccccHHHHHHHHcccccccccHHHHHHHHHHHHHccHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHcc
cHHHHHHHHHcccccEEEcHHHHHHHHHHccccccccccHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHEEcccccHHHHHHHcccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHccc
MLSKKLQRYKKRFLPIIVGGTGLYFRALtgqlsimpeipTAIREKIREKLKQYGShilhdelssLDSIVarqihpsdGQRIARALEIKLVSGQSIIEFWkqapnpfiplesahkiiilpERSALKERIRRRFTQMLESGAIDEIRSLMKMNLsldlpimkAIGVRDIIALLKgeinydetLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF
mlskklqrykkrflpiivggtgLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGeinydetlqRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF
MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF
*LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEF*******FIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID*LF
MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF
MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISS****F
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF
MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF
MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target217
315122496303 tRNA delta(2)-isopentenylpyrophosphate transferase [Can 1 9e-89
227822565312 tRNA delta(2)-isopentenylpyrophosphate transferase [Sin 1 5e-51
325293407298 tRNA delta(2)-isopentenylpyrophosphate transferase [Agr 1 1e-50
86358397297 tRNA delta(2)-isopentenylpyrophosphate transferase [Rhi 1 8e-49
150397212305 tRNA delta(2)-isopentenylpyrophosphate transferase [Sin 1 1e-48
116252992297 tRNA delta(2)-isopentenylpyrophosphate transferase [Rhi 1 2e-48
13471468321 tRNA delta(2)-isopentenylpyrophosphate transferase [Mes 1 3e-48
222149076304 tRNA delta(2)-isopentenylpyrophosphate transferase [Agr 1 5e-48
110634094292 tRNA delta(2)-isopentenylpyrophosphate transferase [Mes 1 5e-48
241205500297 tRNA delta(2)-isopentenylpyrophosphate transferase [Rhi 1 1e-47
>gi|315122496|ref|YP_004062985.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 303 Back     alignment and organism information
 Score =  330 bits (846), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 155/208 (74%), Positives = 181/208 (87%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K   LPIIVGGTGLYFRALTGQ S+MPEIP +IR+ +REKL++YG H+LHDELS +DS  
Sbjct: 96  KNGHLPIIVGGTGLYFRALTGQFSVMPEIPMSIRKNVREKLEKYGPHVLHDELSQIDSCA 155

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A++IH SDGQRIARALEIK+VSGQSI EFWKQ+ NP IP+ESA+KI+ILPERS LK++I 
Sbjct: 156 AQKIHLSDGQRIARALEIKMVSGQSITEFWKQSSNPIIPIESAYKIVILPERSYLKDKIS 215

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           +RF +ML+SGAIDEIRSLMKMNLSLDLPIMKAIGV DI+ALLKGEINY+ETL RGIIATN
Sbjct: 216 QRFKRMLDSGAIDEIRSLMKMNLSLDLPIMKAIGVWDIMALLKGEINYEETLLRGIIATN 275

Query: 190 KYAKRQKTWLCHQFQADWIRISSIDDLF 217
           +YAK+Q TW CHQ   DW +I+S DDL 
Sbjct: 276 QYAKKQITWFCHQLNEDWKKITSADDLL 303


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822565|ref|YP_002826537.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium fredii NGR234] Length = 312 Back     alignment and organism information
>gi|325293407|ref|YP_004279271.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium sp. H13-3] Length = 298 Back     alignment and organism information
>gi|86358397|ref|YP_470289.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium etli CFN 42] Length = 297 Back     alignment and organism information
>gi|150397212|ref|YP_001327679.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium medicae WSM419] Length = 305 Back     alignment and organism information
>gi|116252992|ref|YP_768830.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium leguminosarum bv. viciae 3841] Length = 297 Back     alignment and organism information
>gi|13471468|ref|NP_103034.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium loti MAFF303099] Length = 321 Back     alignment and organism information
>gi|222149076|ref|YP_002550033.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium vitis S4] Length = 304 Back     alignment and organism information
>gi|110634094|ref|YP_674302.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium sp. BNC1] Length = 292 Back     alignment and organism information
>gi|241205500|ref|YP_002976596.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 297 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target217
PRK00091307 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate 1e-58
pfam01715253 pfam01715, IPPT, IPP transferase 3e-49
TIGR00174287 TIGR00174, miaA, tRNA isopentenyltransferase (miaA) 1e-40
PRK14729300 PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosphate 4e-14
PLN02840421 PLN02840, PLN02840, tRNA dimethylallyltransferase 8e-04
COG0324308 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate t 1e-50
PLN02748 468 PLN02748, PLN02748, tRNA dimethylallyltransferase 1e-05
KOG1384348 KOG1384, KOG1384, KOG1384, tRNA delta(2)-isopentenylpyr 9e-05
>gnl|CDD|178856 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>gnl|CDD|145065 pfam01715, IPPT, IPP transferase Back     alignment and domain information
>gnl|CDD|161743 TIGR00174, miaA, tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>gnl|CDD|173191 PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>gnl|CDD|178433 PLN02840, PLN02840, tRNA dimethylallyltransferase Back     alignment and domain information
>gnl|CDD|30672 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178349 PLN02748, PLN02748, tRNA dimethylallyltransferase Back     alignment and domain information
>gnl|CDD|36598 KOG1384, KOG1384, KOG1384, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 217
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 100.0
pfam01715253 IPPT IPP transferase. This is a family of IPP transfera 100.0
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 100.0
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 100.0
KOG1384348 consensus 99.95
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 93.15
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>pfam01715 IPPT IPP transferase Back     alignment and domain information
>TIGR00174 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; InterPro: IPR002627 tRNA isopentenyltransferases 2 Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1384 consensus Back     alignment and domain information
>pfam01745 IPT Isopentenyl transferase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target217
3foz_A316 Structure Of E. Coli Isopentenyl-Trna Transferase I 3e-41
2zm5_A316 Crystal Structure Of Trna Modification Enzyme Miaa 7e-38
3crm_A323 Structure Of Trna Dimethylallyltransferase: Rna Mod 2e-37
2qgn_A322 Crystal Structure Of Trna Isopentenylpyrophosphate 8e-35
3d3q_A340 Crystal Structure Of Trna Delta(2)-Isopentenylpyrop 1e-28
3eph_A 409 Crystallographic Snapshots Of Eukaryotic Dimethylal 3e-23
gi|221046906|pdb|3FOZ|A Chain A, Structure Of E. Coli Isopentenyl-Trna Transferase In Complex With E. Coli Trna(Phe) Length = 316 Back     alignment and structure
 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|226887623|pdb|2ZM5|A Chain A, Crystal Structure Of Trna Modification Enzyme Miaa In The Complex With Trna(Phe) Length = 316 Back     alignment and structure
>gi|186973101|pdb|3CRM|A Chain A, Structure Of Trna Dimethylallyltransferase: Rna Modification Through A Channel Length = 323 Back     alignment and structure
>gi|152149497|pdb|2QGN|A Chain A, Crystal Structure Of Trna Isopentenylpyrophosphate Transferase (Bh2366) From Bacillus Halodurans, Northeast Structural Genomics Consortium Target Bhr41. Length = 322 Back     alignment and structure
>gi|194320048|pdb|3D3Q|A Chain A, Crystal Structure Of Trna Delta(2)-Isopentenylpyrophosphate Transferase (Se0981) From Staphylococcus Epidermidis. Northeast Structural Genomics Consortium Target Ser100 Length = 340 Back     alignment and structure
>gi|211939415|pdb|3EPH|A Chain A, Crystallographic Snapshots Of Eukaryotic Dimethylallyltransferase Acting On Trna: Insight Into Trna Recognition And Reaction Mechanism Length = 409 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target217
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferase; nuc 2e-37
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase; ATP 1e-29
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase; alp 7e-28
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase; alp 8e-24
3eph_A 409 TRNA isopentenyltransferase; transferase, alternative i 7e-17
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold protein 3e-16
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokinin bi 6e-12
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferase; nucleoside modification, isopentenyl-tRNA transferase, MIAA, transferase/RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Length = 316 Back     alignment and structure
 Score =  150 bits (380), Expect = 2e-37
 Identities = 76/209 (36%), Positives = 118/209 (56%), Gaps = 2/209 (0%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
                +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D +
Sbjct: 96  TAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPV 155

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
            A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R  L +RI
Sbjct: 156 AAARIHPNDPQRLSRALEVFFISGKTLTE-LTQTSGDALPYQVHQFAIAPASRELLHQRI 214

Query: 129 RRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            +RF QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ A
Sbjct: 215 EQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCA 274

Query: 188 TNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           T + AKRQ TWL       W+     +  
Sbjct: 275 TRQLAKRQITWLRGWEGVHWLDSEKPEQA 303


>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Length = 323 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 340 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Length = 322 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Length = 409 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Length = 339 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis, plasmid; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Length = 253 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target217
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferase; nuc 100.0
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase; alp 100.0
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase; ATP 100.0
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase; alp 100.0
3eph_A409 TRNA isopentenyltransferase; transferase, alternative i 100.0
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold protein 100.0
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokinin bi 99.37
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferase; nucleoside modification, isopentenyl-tRNA transferase, MIAA, transferase/RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
Probab=100.00  E-value=0  Score=447.18  Aligned_cols=214  Identities=35%  Similarity=0.597  Sum_probs=197.4

Q ss_pred             HHHHH-HHHHCCCCEEEECCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCHHHHH
Q ss_conf             46899-99963994089789327999996172448899989999999999962235556655311623202357015699
Q 537021.9.peg.8    2 LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQR   80 (217)
Q Consensus         2 ~~k~~-e~~~r~kiPIiVGGTglY~~all~g~~~~p~~~~~ir~~~~~~~~~~g~~~l~~~L~~~DP~~a~~i~~nd~~R   80 (217)
                      +.+.+ +++++|++||||||||||++||++|+++.|++|+.+|.++++.....|.+.+|++|+++||++|++||+||++|
T Consensus        88 a~~~i~~i~~~~k~pIlVGGTglYl~all~g~~~~p~~~~~~r~~~~~~~~~~g~~~l~~~L~~iDp~~a~~i~~nd~~R  167 (316)
T 3foz_A           88 ALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQR  167 (316)
T ss_dssp             HHHHHHHHHHTTCEEEEEESCHHHHHHHHSCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHSCTTCHHH
T ss_pred             HHHHHHHHHHCCCCCEEECCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHCHHHHHHCCCCCHHH
T ss_conf             99899999965997089735178999998298779999979988765431016999999999973999996159666889


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHCCCCCCCCHHHEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCHHHHH
Q ss_conf             99999998534887467754154567770010000107867899999997776542113456777751138-63101344
Q 537021.9.peg.8   81 IARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMN-LSLDLPIM  159 (217)
Q Consensus        81 i~RaLEi~~~tGk~~s~~~~~~~~~~~~~~~~~~i~l~~~r~~L~~rI~~R~~~Ml~~GlieEv~~L~~~~-~~~~~~~~  159 (217)
                      |+|||||+..||+++|+|+...+.+ .++..+.++++.+||+.||+||+.||+.|+++||++||+.|++++ ++.+++++
T Consensus       168 i~RAlEv~~~tGk~~s~~~~~~~~~-~~~~~~~i~~~~~~re~L~~rI~~Rv~~Ml~~GlieEv~~L~~~~~~~~~~~~~  246 (316)
T 3foz_A          168 LSRALEVFFISGKTLTELTQTSGDA-LPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSI  246 (316)
T ss_dssp             HHHHHHHHHHHSSCHHHHHTSCCCC-CSSEEEEEEEECSSHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHSCCCTTSTTT
T ss_pred             HHHHHHHHHHHCCCHHHHHHCCCCC-CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCHHHH
T ss_conf             9999999996179878886313788-887633899618999999999999999998740899999999843677431555


Q ss_pred             HCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHCC
Q ss_conf             206856778986789998999999999999888887688628887531169830104
Q 537021.9.peg.8  160 KAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL  216 (217)
Q Consensus       160 ~~IGYke~~~yL~g~~~~~e~~e~~~~~Tr~yAKRQ~TWfr~~~~~~w~~~~~~d~i  216 (217)
                      +||||||+.+||+|+++++++++.++++||||||||+||||++++++|++.++++++
T Consensus       247 ~aIGYkE~~~yL~g~~s~~eaie~i~~~TrqyAKRQ~TWfR~~~~i~wid~~~~~~~  303 (316)
T 3foz_A          247 RCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQA  303 (316)
T ss_dssp             TSTTHHHHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHSCSSCEEEETTCHHHH
T ss_pred             HEECHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCHHHH
T ss_conf             413699999998599999999999999999999998898389998758789886899



>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis, plasmid; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 217
3eph_A_1-111_185-343270 (A:1-111,A:185-343) TRNA isopentenyltransferase; t 3e-19
3crm_A_213-29684 (A:213-296) TRNA delta(2)-isopentenylpyrophosphate 1e-18
3foz_A_206-28984 (A:206-289) TRNA delta(2)-isopentenylpyrophosphate 2e-18
3exa_A_201-28282 (A:201-282) TRNA delta(2)-isopentenylpyrophosphate 1e-17
3d3q_A_207-28882 (A:207-288) TRNA delta(2)-isopentenylpyrophosphate 1e-17
3a8t_A_184-294111 (A:184-294) Adenylate isopentenyltransferase; ross 7e-16
3eph_A_112-18473 (A:112-184) TRNA isopentenyltransferase; transfera 2e-13
3crm_A_1-212_297-323239 (A:1-212,A:297-323) TRNA delta(2)-isopentenylpyrop 1e-11
3d3q_A_120-18162 (A:120-181) TRNA delta(2)-isopentenylpyrophosphate 2e-10
3exa_A_1-200_283-322240 (A:1-200,A:283-322) TRNA delta(2)-isopentenylpyrop 2e-09
3foz_A_1-205_290-316232 (A:1-205,A:290-316) TRNA delta(2)-isopentenylpyrop 3e-09
2ze6_A_1-125125 (A:1-125) Isopentenyl transferase; crown GALL tumo 0.004
>3eph_A (A:1-111,A:185-343) TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*Length = 270 Back     alignment and structure
 Score = 89.7 bits (222), Expect = 3e-19
 Identities = 24/115 (20%), Positives = 46/115 (40%), Gaps = 12/115 (10%)

Query: 107 IPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMK-------MNLSLDLPIM 159
                   + +  +   L +R+  R   MLE GA+ EI+ L +            +  + 
Sbjct: 111 RLKFDTLFLWLYSKPEPLFQRLDDRVDDMLERGALQEIKQLYEYYSQNKFTPEQCENGVW 170

Query: 160 KAIGVRDIIALLKGE-----INYDETLQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           + IG ++ +  L G+     +  ++ ++R    T +YAKRQ  W+      D   
Sbjct: 171 QVIGFKEFLPWLTGKTDDNTVKLEDCIERMKTRTRQYAKRQVKWIKKMLIPDIKG 225


>3crm_A (A:213-296) TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_ALength = 84 Back     alignment and structure
>3foz_A (A:206-289) TRNA delta(2)-isopentenylpyrophosphate transferase; nucleoside modification, isopentenyl-tRNA transferase, MIAA, transferase/RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_ALength = 84 Back     alignment and structure
>3exa_A (A:201-282) TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_ALength = 82 Back     alignment and structure
>3d3q_A (A:207-288) TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}Length = 82 Back     alignment and structure
>3a8t_A (A:184-294) Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}Length = 111 Back     alignment and structure
>3eph_A (A:112-184) TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*Length = 73 Back     alignment and structure
>3crm_A (A:1-212,A:297-323) TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_ALength = 239 Back     alignment and structure
>3d3q_A (A:120-181) TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}Length = 62 Back     alignment and structure
>3exa_A (A:1-200,A:283-322) TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_ALength = 240 Back     alignment and structure
>3foz_A (A:1-205,A:290-316) TRNA delta(2)-isopentenylpyrophosphate transferase; nucleoside modification, isopentenyl-tRNA transferase, MIAA, transferase/RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_ALength = 232 Back     alignment and structure
>2ze6_A (A:1-125) Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis, plasmid; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_ALength = 125 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target217
3eph_A_1-111_185-343270 TRNA isopentenyltransferase; transferase, alternat 100.0
3crm_A_213-29684 TRNA delta(2)-isopentenylpyrophosphate transferase 99.93
3exa_A_201-28282 TRNA delta(2)-isopentenylpyrophosphate transferase 99.93
3a8t_A_184-294111 Adenylate isopentenyltransferase; rossmann fold pr 99.93
3foz_A_206-28984 TRNA delta(2)-isopentenylpyrophosphate transferase 99.93
3d3q_A_207-28882 TRNA delta(2)-isopentenylpyrophosphate transferase 99.92
2ze6_A_126-253128 Isopentenyl transferase; crown GALL tumor, cytokin 93.75
3crm_A_1-212_297-323239 TRNA delta(2)-isopentenylpyrophosphate transferase 99.73
3exa_A_1-200_283-322240 TRNA delta(2)-isopentenylpyrophosphate transferase 99.42
3foz_A_1-205_290-316232 TRNA delta(2)-isopentenylpyrophosphate transferase 99.08
3eph_A_112-18473 TRNA isopentenyltransferase; transferase, alternat 99.61
3d3q_A_120-18162 TRNA delta(2)-isopentenylpyrophosphate transferase 99.25
2ze6_A_1-125125 Isopentenyl transferase; crown GALL tumor, cytokin 96.58
3d3q_A_1-119_196-206_289-340182 TRNA delta(2)-isopentenylpyrophosphate transferase 96.53
3a8t_A_1-183_295-339228 Adenylate isopentenyltransferase; rossmann fold pr 96.52
>3eph_A (A:1-111,A:185-343) TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
Probab=100.00  E-value=2.9e-34  Score=245.02  Aligned_cols=142  Identities=20%  Similarity=0.281  Sum_probs=110.7

Q ss_pred             CCHHHHHH-HHHHHHHHHCCCCHH-----HHHHHCCCCCCCCHHHEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             70156999-999999853488746-----775415456777001000010786789999999777654211345677775
Q 537021.9.peg.8   74 HPSDGQRI-ARALEIKLVSGQSII-----EFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSL  147 (217)
Q Consensus        74 ~~nd~~Ri-~RaLEi~~~tGk~~s-----~~~~~~~~~~~~~~~~~~i~l~~~r~~L~~rI~~R~~~Ml~~GlieEv~~L  147 (217)
                      ..++.... .++++-...+|+.+.     -+..+.-....+.+++++|||++||+.|++||+.||+.|+++||++||+.|
T Consensus        72 ~~~~f~~~a~~~~~~i~~~~~~~IivgGt~~yl~~~~~~l~~~~~l~~~l~~~r~~L~~ri~~Rvd~M~~~Gl~~Ev~~l  151 (270)
T 3eph_A           72 YSHRFETECMNAIEDIHRRGKIPIVVGGTHYYLQTLFNKRLKFDTLFLWLYSKPEPLFQRLDDRVDDMLERGALQEIKQL  151 (270)
T ss_dssp             CHHHHHHHHHHHHHHHHTTTCEEEEECSCGGGGGGGGTCSCSSEEEEEEEECCHHHHHHHHHHHHHHHHHTTHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             89999999998654554045732896798615998863022212222245788788999999999999977769999999


Q ss_pred             HHCC-------CCCHHHHHHCCCHHHHHHHHCCC-----CCHHHHHHHHHHHHHHHHHHHHHHHCCC------CCCCCCC
Q ss_conf             1138-------63101344206856778986789-----9989999999999998888876886288------8753116
Q 537021.9.peg.8  148 MKMN-------LSLDLPIMKAIGVRDIIALLKGE-----INYDETLQRGIIATNKYAKRQKTWLCHQ------FQADWIR  209 (217)
Q Consensus       148 ~~~~-------~~~~~~~~~~IGYke~~~yL~g~-----~~~~e~~e~~~~~Tr~yAKRQ~TWfr~~------~~~~w~~  209 (217)
                      ++.+       .+.+.++++||||||+.+||+|+     .++++|++.++++||||||||+|||||+      .+++|+|
T Consensus       152 ~~~~~~~~~~~~~~~~~~~qaIGykE~~~yl~~~~~~~~~~~~e~~~~~~~~Tr~yAKrQ~tWfr~~~~~~~~~~i~~ld  231 (270)
T 3eph_A          152 YEYYSQNKFTPEQCENGVWQVIGFKEFLPWLTGKTDDNTVKLEDCIERMKTRTRQYAKRQVKWIKKMLIPDIKGDIYLLD  231 (270)
T ss_dssp             HHHHTTTTCCGGGTTSGGGGSTTTGGGGGGGC-------CCHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHTTTCEEEEE
T ss_pred             HHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             97336565673210126887734999999973877656358999999999999999999999986434311489743047


Q ss_pred             CCCHHC
Q ss_conf             983010
Q 537021.9.peg.8  210 ISSIDD  215 (217)
Q Consensus       210 ~~~~d~  215 (217)
                      .++.++
T Consensus       232 ~~~~~~  237 (270)
T 3eph_A          232 ATDLSQ  237 (270)
T ss_dssp             CSCTTT
T ss_pred             CHHHHH
T ss_conf             416778



>3crm_A (A:213-296) TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3exa_A (A:201-282) TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3a8t_A (A:184-294) Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3foz_A (A:206-289) TRNA delta(2)-isopentenylpyrophosphate transferase; nucleoside modification, isopentenyl-tRNA transferase, MIAA, transferase/RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3d3q_A (A:207-288) TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2ze6_A (A:126-253) Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis, plasmid; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3crm_A (A:1-212,A:297-323) TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3exa_A (A:1-200,A:283-322) TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3foz_A (A:1-205,A:290-316) TRNA delta(2)-isopentenylpyrophosphate transferase; nucleoside modification, isopentenyl-tRNA transferase, MIAA, transferase/RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3eph_A (A:112-184) TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3d3q_A (A:120-181) TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2ze6_A (A:1-125) Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis, plasmid; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3d3q_A (A:1-119,A:196-206,A:289-340) TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3a8t_A (A:1-183,A:295-339) Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure