peg_911

peg_911

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(978714, 978857)Protein Length:47aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40-------
LEIVSQVERYAKGANRIRLKVKYSILFLILSALHLKNKVRYGAVKKY
cHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHHHccccccccEEcc
ccHHHHHHHHHHcccHHEEHHHHHHHHHHHHHHHHHHccccccEEcc
LEIVSQVERYAKGANRIRLKVKYSILFLILSALHLKNkvrygavkky
LEIVSQVERyakganrirlkvKYSILFLILsalhlknkvrygavkky
LEIVSQVERYAKGANRIRLKVKYSILFLILSALHLKNKVRYGAVKKY
*EI*SQ*ERYAKGANRIRLKVKYSILFLILSALHLKNKVRYG*V***
LEIVSQVERYAKGANRIRLKVKYSILFLILSALHLKNKVRYGAVKKY
LEIVSQVERYAKGANRIRLKVKYSILFLILSALHLKNKVRYGAVKKY
ooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LEIVSQVERYAKGANRIRLKVKYSILFLILSALHLKNKVRYGAVKKY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target47
254780134348 phage-related integrase/recombinase [Candidatus Li 0.014
>gi|254780134|ref|YP_003064547.1| phage-related integrase/recombinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 29.3 bits (64), Expect = 0.014,   Method: Composition-based stats.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 2   EIVSQVERYAKGANRIRLKVKYS 24
           + V Q E Y KGA+RIRL +K S
Sbjct: 314 KTVDQAETYTKGADRIRLGIKNS 336

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00