254780980

254780980

hypothetical protein CLIBASIA_04405

GeneID in NCBI database:8210002Locus tag:CLIBASIA_04405
Protein GI in NCBI database:254780980Protein Accession:YP_003065393.1
Gene range:-(978205, 978570)Protein Length:121aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPSN
cccEEEEEcccHHHEEEEcccEEEEEcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHEEEEccccc
cccEEEEEcHHHHHHHHcccccEEEccHHHHHHHHHHccHHHHHHHcccEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccEEEEEEEEEEccccc
MKAKILMTSAFSTTLLTiggcdiviGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKLSVDELANAFWdlsdedknaftgnVKQEVCkvkkitvppsn
MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVeeratasrklsvDELANAFWDLsdedknaftgnvkqevckvkkitvppsn
MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQerveaaekrvkeveeraTASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPSN
*******TSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRL****************************ELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVP***
MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERV*****************RKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPSN
*KAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETxxxxxxxxxxxxxxxxxxxxxxxxxxxxSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPSN
MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPSN
MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPSN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target121 hypothetical protein CLIBASIA_04405 [Candidatus Liberib
254780556120 hypothetical protein CLIBASIA_02215 [Candidatus Li 7e-14
>gi|254780556|ref|YP_003064969.1| hypothetical protein CLIBASIA_02215 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Back     alignment
 Score = 67.4 bits (163), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 10/108 (9%)

Query: 1   MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQER 60
           M+AK L+ S   TT +TI GC +V    ED  N+++  S +M+KEA  ++ E H+LA+E 
Sbjct: 1   MRAKTLLASTLVTTAITIIGCSLV----ED--NRIE--SLRMVKEAKMEVLEAHKLAKEY 52

Query: 61  VEAAEKRVKEVEERATAS--RKLSVDELANAFWDLSDEDKNAFTGNVK 106
           VE A +RVKE EE++ A   + L +D+L   F +L  +++  F   ++
Sbjct: 53  VEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQ 100

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target121 hypothetical protein CLIBASIA_04405 [Candidatus Liberib
254780556120 hypothetical protein CLIBASIA_02215 [Candidatus Liberib 1 6e-10
>gi|254780556|ref|YP_003064969.1| hypothetical protein CLIBASIA_02215 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Back     alignment and organism information
 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 10/108 (9%)

Query: 1   MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQER 60
           M+AK L+ S   TT +TI GC +V    ED  N+++  S +M+KEA  ++ E H+LA+E 
Sbjct: 1   MRAKTLLASTLVTTAITIIGCSLV----ED--NRIE--SLRMVKEAKMEVLEAHKLAKEY 52

Query: 61  VEAAEKRVKEVEERATAS--RKLSVDELANAFWDLSDEDKNAFTGNVK 106
           VE A +RVKE EE++ A   + L +D+L   F +L  +++  F   ++
Sbjct: 53  VEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQ 100


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 121 hypothetical protein CLIBASIA_04405 [Candidatus Liberib
TIGR01010 364 BexC_CtrB_KpsE polysaccharide export inner-membrane pro 90.47
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family; InterPro: IPR005705 This family contains gamma proteobacterial proteins involved in ATP-dependent capsule polysaccharide export , Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00