254780476

254780476

two component response regulator

GeneID in NCBI database:8209465Locus tag:CLIBASIA_01805
Protein GI in NCBI database:254780476Protein Accession:YP_003064889.1
Gene range:-(398455, 398826)Protein Length:123aa
Gene description:two component response regulator
COG prediction:[T] FOG: CheY-like receiver
KEGG prediction:two component response regulator; K11443 two-component system, cell cycle response regulator DivK
SEED prediction:PUTATIVE 2-COMPONENT RECEIVER DOMAIN PROTEIN
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA
cccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHcc
cccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHcccEEEEEcEccccEHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHcc
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQikedselqeiPVIAVTAFAMKGDEERIRKGgceayiskpiSLSIFMETIKKYIGEA
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIkedselqeipVIAVTAFAMKGDEERIRKGGceayiskpislsiFMETIKKYIGEA
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE*
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA
*LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target123 two component response regulator [Candidatus Liberibact
254780450803 two-component sensor histidine kinase/response reg 4e-06
254780893 236 two component response regulator [Candidatus Liber 5e-06
254780312122 response regulator receiver protein [Candidatus Li 9e-06
>gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment 
 Score = 41.6 bits (96), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR--QHKPDVIIMDIQLQEISGL 62
           V++VED +   +  + ++ET GY   +  +G +AL++    Q + D++I D+ + E+ G 
Sbjct: 684 VLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGP 743

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            + +++++      +  I ++ +A     + + K    +++SKP SL
Sbjct: 744 TLLRELRK--TYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSL 788
>gi|254780893|ref|YP_003065306.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 236 Back     alignment 
 Score = 41.2 bits (95), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++++ED++        ++++  +    T  G + +EL + ++ D II+D+ L +I G E
Sbjct: 2   RILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           + + ++        PV  ++  +   D+ R  + G + YISKP +
Sbjct: 62  VLRALRVAK--ISTPVCILSGMSSIEDKVRGLQSGADDYISKPFN 104
>gi|254780312|ref|YP_003064725.1| response regulator receiver protein [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Back     alignment 
 Score = 40.4 bits (93), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++ ED++   +     +  +GY  +   NG  A +  R+    +++ DI + E+ 
Sbjct: 1   MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMD 60

Query: 61  GLEITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           G+E+ ++  E D +L+ + +    A A+  D    +       +SKP  L   +  + + 
Sbjct: 61  GIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKV---LSKPFHLRDLVNEVNRL 117

Query: 120 I 120
           +
Sbjct: 118 L 118

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target123 two component response regulator [Candidatus Liberibact
315122068123 two component response regulator [Candidatus Liberibact 1 5e-59
222148303123 two component response regulator [Agrobacterium vitis S 1 3e-52
15965046123 putative 2-component receiver domain protein [Sinorhizo 1 1e-51
227821648149 putative response regulator in two-component regulatory 1 3e-51
86357266123 two-component response regulator protein [Rhizobium etl 1 3e-51
319783843123 response regulator receiver [Mesorhizobium ciceri biova 1 5e-51
222085607133 two-component response regulator protein [Agrobacterium 1 6e-51
260463924138 response regulator receiver protein [Mesorhizobium oppo 1 1e-50
218678690123 response regulator receiver protein [Rhizobium etli CIA 1 2e-50
159184699123 two component response regulator [Agrobacterium tumefac 1 2e-50
>gi|315122068|ref|YP_004062557.1| two component response regulator [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 123 Back     alignment and organism information
 Score =  230 bits (587), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 121/123 (98%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDLIETSGY+++QTR+G+EALE+ARQHKPD+IIMDIQL EIS
Sbjct: 1   MPKKVMIVEDNELNMKLFRDLIETSGYMSIQTRSGLEALEIARQHKPDIIIMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEITKQIKED+ELQ+IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI
Sbjct: 61  GLEITKQIKEDNELQDIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120

Query: 121 GEA 123
           GEA
Sbjct: 121 GEA 123



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148303|ref|YP_002549260.1| two component response regulator [Agrobacterium vitis S4] Length = 123 Back     alignment and organism information
>gi|15965046|ref|NP_385399.1| putative 2-component receiver domain protein [Sinorhizobium meliloti 1021] Length = 123 Back     alignment and organism information
>gi|227821648|ref|YP_002825618.1| putative response regulator in two-component regulatory system [Sinorhizobium fredii NGR234] Length = 149 Back     alignment and organism information
>gi|86357266|ref|YP_469158.1| two-component response regulator protein [Rhizobium etli CFN 42] Length = 123 Back     alignment and organism information
>gi|319783843|ref|YP_004143319.1| response regulator receiver [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 123 Back     alignment and organism information
>gi|222085607|ref|YP_002544137.1| two-component response regulator protein [Agrobacterium radiobacter K84] Length = 133 Back     alignment and organism information
>gi|260463924|ref|ZP_05812120.1| response regulator receiver protein [Mesorhizobium opportunistum WSM2075] Length = 138 Back     alignment and organism information
>gi|218678690|ref|ZP_03526587.1| response regulator receiver protein [Rhizobium etli CIAT 894] Length = 123 Back     alignment and organism information
>gi|159184699|ref|NP_354304.2| two component response regulator [Agrobacterium tumefaciens str. C58] Length = 123 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target123 two component response regulator [Candidatus Liberibact
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinase Bar 7e-21
pfam00072111 pfam00072, Response_reg, Response regulator receiver do 4e-20
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal transduc 2e-16
TIGR02154 226 TIGR02154, PhoB, phosphate regulon transcriptional regu 2e-16
COG3437 360 COG3437, COG3437, Response regulator containing a CheY- 3e-15
KOG0519786 KOG0519, KOG0519, KOG0519, Sensory transduction histidi 2e-14
PRK15347 921 PRK15347, PRK15347, two component system sensor kinase 3e-14
PRK11091 779 PRK11091, PRK11091, aerobic respiration control sensor 4e-14
PRK09581 457 PRK09581, pleD, response regulator PleD; Reviewed 1e-13
COG0745 229 COG0745, OmpR, Response regulators consisting of a CheY 7e-13
COG2204 464 COG2204, AtoC, Response regulator containing CheY-like 7e-13
COG2197211 COG2197, CitB, Response regulator containing a CheY-lik 3e-12
COG4753 475 COG4753, COG4753, Response regulator containing CheY-li 2e-11
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS 2e-11
COG2201 350 COG2201, CheB, Chemotaxis response regulator containing 3e-11
COG3706 435 COG3706, PleD, Response regulator containing a CheY-lik 2e-10
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regulatory 5e-10
PRK09191261 PRK09191, PRK09191, two-component response regulator; P 1e-09
PRK10365 441 PRK10365, PRK10365, transcriptional regulatory protein 5e-09
PRK00742 354 PRK00742, PRK00742, chemotaxis-specific methylesterase; 5e-09
TIGR01387 218 TIGR01387, cztR_silR_copR, heavy metal response regulat 7e-09
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-compon 7e-09
PRK10161 229 PRK10161, PRK10161, transcriptional regulator PhoB; Pro 7e-09
CHL00148 240 CHL00148, orf27, Ycf27; Reviewed 2e-08
PRK10710 240 PRK10710, PRK10710, DNA-binding transcriptional regulat 2e-08
TIGR02875 262 TIGR02875, spore_0_A, sporulation transcription factor 3e-08
PRK10610129 PRK10610, PRK10610, chemotaxis regulatory protein CheY; 3e-08
COG3947 361 COG3947, COG3947, Response regulator containing CheY-li 5e-08
COG4566202 COG4566, TtrR, Response regulator [Signal transduction 7e-08
COG3707194 COG3707, AmiR, Response regulator with putative antiter 1e-07
PRK11517 223 PRK11517, PRK11517, transcriptional regulatory protein 1e-07
COG4565 224 COG4565, CitB, Response regulator of citrate/malate met 4e-07
PRK11697 238 PRK11697, PRK11697, putative two-component response-reg 6e-07
PRK15369211 PRK15369, PRK15369, two component system sensor kinase 8e-07
PRK10529 225 PRK10529, PRK10529, DNA-binding transcriptional activat 1e-06
PRK12555 337 PRK12555, PRK12555, chemotaxis-specific methylesterase; 1e-06
PRK10403215 PRK10403, PRK10403, transcriptional regulator NarP; Pro 1e-06
PRK10766 221 PRK10766, PRK10766, DNA-binding transcriptional regulat 2e-06
PRK10651216 PRK10651, PRK10651, transcriptional regulator NarL; Pro 4e-06
PLN03029222 PLN03029, PLN03029, type-a response regulator protein; 6e-06
COG4567182 COG4567, COG4567, Response regulator consisting of a Ch 7e-06
PRK13435145 PRK13435, PRK13435, response regulator; Provisional 8e-06
PRK09836 227 PRK09836, PRK09836, DNA-binding transcriptional activat 9e-06
COG3706 435 COG3706, PleD, Response regulator containing a CheY-lik 1e-05
PRK15115 444 PRK15115, PRK15115, response regulator GlrR; Provisiona 3e-05
COG3279 244 COG3279, LytT, Response regulator of the LytR/AlgR fami 4e-05
TIGR03787 227 TIGR03787, marine_sort_RR, proteobacterial dedicated so 4e-05
PRK10693 303 PRK10693, PRK10693, response regulator of RpoS; Provisi 1e-04
PRK09483217 PRK09483, PRK09483, response regulator; Provisional 1e-04
PRK10923 469 PRK10923, glnG, nitrogen regulation protein NR(I); Prov 1e-04
PRK10955 232 PRK10955, PRK10955, DNA-binding transcriptional regulat 2e-04
TIGR01818 463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 3e-04
PRK09958204 PRK09958, PRK09958, DNA-binding transcriptional activat 6e-04
PRK15479 221 PRK15479, PRK15479, transcriptional regulatory protein 0.001
cd00156113 cd00156, REC, Signal receiver domain; originally though 3e-20
smart0044855 smart00448, REC, cheY-homologous receiver domain 6e-11
PRK11173 237 PRK11173, PRK11173, two-component response regulator; P 0.001
PRK11083 228 PRK11083, PRK11083, DNA-binding response regulator CreB 6e-08
>gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|143854 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|31127 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|33243 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|181966 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|31088 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|34367 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|32383 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|181686 PRK09191, PRK09191, two-component response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|179106 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|182277 PRK10161, PRK10161, transcriptional regulator PhoB; Provisional Back     alignment and domain information
>gnl|CDD|164540 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|182665 PRK10710, PRK10710, DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A Back     alignment and domain information
>gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>gnl|CDD|33728 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33502 COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183278 PRK11697, PRK11697, putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>gnl|CDD|185267 PRK15369, PRK15369, two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>gnl|CDD|182522 PRK10529, PRK10529, DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>gnl|CDD|183591 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|182431 PRK10403, PRK10403, transcriptional regulator NarP; Provisional Back     alignment and domain information
>gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>gnl|CDD|182619 PRK10651, PRK10651, transcriptional regulator NarL; Provisional Back     alignment and domain information
>gnl|CDD|178599 PLN03029, PLN03029, type-a response regulator protein; Provisional Back     alignment and domain information
>gnl|CDD|34205 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|184052 PRK13435, PRK13435, response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|33090 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163499 TIGR03787, marine_sort_RR, proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional Back     alignment and domain information
>gnl|CDD|181897 PRK09483, PRK09483, response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>gnl|CDD|162545 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|182168 PRK09958, PRK09958, DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|29071 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|128724 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|183013 PRK11173, PRK11173, two-component response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182950 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 123 two component response regulator [Candidatus Liberibact
TIGR02154 226 PhoB phosphate regulon transcriptional regulatory prote 100.0
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 100.0
PRK09581 457 pleD response regulator PleD; Reviewed 100.0
PRK10841947 hybrid sensory kinase in two-component regulatory syste 100.0
PRK10161 229 transcriptional regulator PhoB; Provisional 100.0
PRK11091 779 aerobic respiration control sensor protein ArcB; Provis 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 99.97
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.97
PRK10693 337 response regulator of RpoS; Provisional 99.97
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisional 99.97
TIGR01387 219 cztR_silR_copR heavy metal response regulator; InterPro 99.97
CHL00148 240 orf27 Ycf27; Reviewed 99.97
PRK11466 912 hybrid sensory histidine kinase TorS; Provisional 99.97
PRK11083 229 DNA-binding response regulator CreB; Provisional 99.97
PRK09836 226 DNA-binding transcriptional activator CusR; Provisional 99.97
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 99.97
PRK10701 240 DNA-binding transcriptional regulator RstA; Provisional 99.97
pfam00072111 Response_reg Response regulator receiver domain. This d 99.97
PRK11517 223 transcriptional regulatory protein YedW; Provisional 99.96
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; Provis 99.96
PRK09468 239 ompR osmolarity response regulator; Provisional 99.96
PRK10955 232 DNA-binding transcriptional regulator CpxR; Provisional 99.96
PRK10529 225 DNA-binding transcriptional activator KdpE; Provisional 99.96
PRK10766 224 DNA-binding transcriptional regulator TorR; Provisional 99.96
cd00156113 REC Signal receiver domain; originally thought to be un 99.96
PRK11173 237 two-component response regulator; Provisional 99.96
COG0745 229 OmpR Response regulators consisting of a CheY-like rece 99.96
PRK10365 441 transcriptional regulatory protein ZraR; Provisional 99.96
PRK13557538 histidine kinase; Provisional 99.96
PRK10046225 dpiA two-component response regulator DpiA; Provisional 99.96
PRK13856 241 two-component response regulator VirG; Provisional 99.96
PRK10710 240 DNA-binding transcriptional regulator BaeR; Provisional 99.95
PRK10643 222 DNA-binding transcriptional regulator BasR; Provisional 99.95
KOG0519786 consensus 99.95
PRK10816 223 DNA-binding transcriptional regulator PhoP; Provisional 99.95
PRK09390202 fixJ response regulator FixJ; Provisional 99.95
PRK10430 239 DNA-binding transcriptional activator DcuR; Provisional 99.94
TIGR02875 270 spore_0_A sporulation transcription factor Spo0A; Inter 99.94
COG2204 464 AtoC Response regulator containing CheY-like receiver, 99.94
COG4753 475 Response regulator containing CheY-like receiver domain 99.94
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 99.94
PRK13435141 response regulator; Provisional 99.93
COG3437 360 Response regulator containing a CheY-like receiver doma 99.92
PRK00742 345 chemotaxis-specific methylesterase; Provisional 99.92
TIGR01818 471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 99.92
COG3706 435 PleD Response regulator containing a CheY-like receiver 99.92
PRK12555 340 chemotaxis-specific methylesterase; Provisional 99.9
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 99.89
PRK09483216 response regulator; Provisional 99.89
PRK10651216 transcriptional regulator NarL; Provisional 99.88
PRK10403215 transcriptional regulator NarP; Provisional 99.88
COG4565 224 CitB Response regulator of citrate/malate metabolism [T 99.86
COG4566202 TtrR Response regulator [Signal transduction mechanisms 99.86
PRK09935210 transcriptional regulator FimZ; Provisional 99.86
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 99.86
COG2197211 CitB Response regulator containing a CheY-like receiver 99.85
COG0784130 CheY FOG: CheY-like receiver [Signal transduction mecha 99.84
PRK13837831 two-component VirA-like sensor kinase; Provisional 99.84
PRK10840216 transcriptional regulator RcsB; Provisional 99.83
PRK11697 239 putative two-component response-regulatory protein YehT 99.83
COG3947 361 Response regulator containing CheY-like receiver and SA 99.8
PRK09191261 two-component response regulator; Provisional 99.8
COG2201 350 CheB Chemotaxis response regulator containing a CheY-li 99.74
TIGR02915 451 PEP_resp_reg putative PEP-CTERM system response regulat 99.73
COG4567182 Response regulator consisting of a CheY-like receiver d 99.69
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 99.67
PRK13558 674 bacterio-opsin activator; Provisional 99.62
COG3707194 AmiR Response regulator with putative antiterminator ou 99.61
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 99.47
COG3279 244 LytT Response regulator of the LytR/AlgR family [Transc 99.37
PRK09581 457 pleD response regulator PleD; Reviewed 99.31
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 99.28
COG3706 435 PleD Response regulator containing a CheY-like receiver 99.22
pfam06490109 FleQ Flagellar regulatory protein FleQ. This domain is 98.6
cd02067119 B12-binding B12 binding domain (B12-BD). This domain bi 97.24
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 97.03
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) 96.35
COG4999140 Uncharacterized domain of BarA-like signal transduction 96.25
PRK02261137 methylaspartate mutase subunit S; Provisional 96.2
cd02070201 corrinoid_protein_B12-BD B12 binding domain of corrinoi 95.82
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit 95.82
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding 95.25
PRK07206 415 hypothetical protein; Provisional 94.54
pfam00563233 EAL EAL domain. This domain is found in diverse bacteri 94.41
PRK09426715 methylmalonyl-CoA mutase; Reviewed 94.11
PRK10551518 hypothetical protein; Provisional 92.33
cd01948240 EAL EAL domain. This domain is found in diverse bacteri 91.51
smart00052241 EAL Putative diguanylate phosphodiesterase. Putative di 91.29
pfam05582287 Peptidase_U57 YabG peptidase U57. YabG is a protease in 91.21
PRK097761116 putative sensor protein; Provisional 91.11
pfam02310121 B12-binding B12 binding domain. This domain binds to B1 91.03
cd02068127 radical_SAM_B12_BD B12 binding domain_like associated w 90.87
TIGR02855292 spore_yabG sporulation peptidase YabG; InterPro: IPR008 90.86
PRK05928252 hemD uroporphyrinogen-III synthase; Reviewed 90.65
COG2200256 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Si 90.16
PRK10060663 RNase II stability modulator; Provisional 90.01
smart0044855 REC cheY-homologous receiver domain. CheY regulates the 99.14
PRK13566724 anthranilate synthase; Provisional 96.97
pfam03709111 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain 96.61
PRK09522 531 bifunctional anthranilate synthase/anthranilate phospho 95.38
PRK05637208 anthranilate synthase component II; Provisional 95.28
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 94.38
PRK06895191 para-aminobenzoate synthase component II; Provisional 92.92
PRK00758184 GMP synthase subunit A; Validated 92.31
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB; InterPro: IPR011879 PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator; InterPro: IPR006291 Members of this family contain a response regulator receiver domain and an associated transcriptional regulatory region Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>pfam00072 Response_reg Response regulator receiver domain Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A; InterPro: IPR012052 Members of this group are response regulators/transcription factors that contain CheY-like receiver (phosphoacceptor) domain and a unique DNA-binding domain Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114 This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264 Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT) Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>pfam06490 FleQ Flagellar regulatory protein FleQ Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium) Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>pfam00563 EAL EAL domain Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information
>PRK10551 hypothetical protein; Provisional Back     alignment and domain information
>cd01948 EAL EAL domain Back     alignment and domain information
>smart00052 EAL Putative diguanylate phosphodiesterase Back     alignment and domain information
>pfam05582 Peptidase_U57 YabG peptidase U57 Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>pfam02310 B12-binding B12 binding domain Back     alignment and domain information
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain Back     alignment and domain information
>TIGR02855 spore_yabG sporulation peptidase YabG; InterPro: IPR008764 Peptidases are grouped into clans and families Back     alignment and domain information
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>COG2200 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>pfam03709 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain Back     alignment and domain information
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06895 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target123 two component response regulator [Candidatus Liberibact
1zes_A125 Bef3- Activated Phob Receiver Domain Length = 125 2e-40
2iyn_A124 The Co-Factor-Induced Pre-Active Conformation In Ph 3e-40
1b00_A127 Phob Receiver Domain From Escherichia Coli Length = 4e-40
1mvo_A136 Crystal Structure Of The Phop Receiver Domain From 5e-40
1nxo_A120 Micarec Ph7.0 Length = 120 2e-39
2jba_A127 Phob Response Regulator Receiver Domain Constitutiv 3e-39
1nxt_A120 Micarec Ph 4.0 Length = 120 3e-39
2jba_B127 Phob Response Regulator Receiver Domain Constitutiv 4e-39
3f6p_A120 Crystal Structure Of Unphosphorelated Receiver Doma 3e-38
2jb9_A127 Phob Response Regulator Receiver Domain Constitutiv 3e-38
2zwm_A130 Crystal Structure Of Yycf Receiver Domain From Baci 3e-38
2wb4_A 459 Activated Diguanylate Cyclase Pled In Complex With 2e-36
2wb4_A 459 Activated Diguanylate Cyclase Pled In Complex With 2e-12
3dge_C122 Structure Of A Histidine Kinase-Response Regulator 9e-36
3gl9_A122 The Structure Of A Histidine Kinase-Response Regula 1e-35
1m5t_A124 Crystal Structure Of The Response Regulator Divk Le 2e-35
1w25_A 459 Response Regulator Pled In Complex With C-Digmp Len 5e-35
1w25_A 459 Response Regulator Pled In Complex With C-Digmp Len 3e-12
2oqr_A 230 The Structure Of The Response Regulator Regx3 From 9e-35
>gi|78101053|pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain Length = 125 Back     alignment and structure 
 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122
>gi|114794859|pdb|2IYN|A Chain A, The Co-Factor-Induced Pre-Active Conformation In Phob Length = 124 Back     alignment and structure
gi|6573458|pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli Length = 127 Back     alignment and structure
>gi|24987831|pdb|1MVO|A Chain A, Crystal Structure Of The Phop Receiver Domain From Bacillus Subtilis Length = 136 Back     alignment and structure
>gi|46014953|pdb|1NXO|A Chain A, Micarec Ph7.0 Length = 120 Back     alignment and structure
>gi|126031095|pdb|2JBA|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 Back     alignment and structure
>gi|46014956|pdb|1NXT|A Chain A, Micarec Ph 4.0 Length = 120 Back     alignment and structure
>gi|126031096|pdb|2JBA|B Chain B, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 Back     alignment and structure
>gi|290560102|pdb|3F6P|A Chain A, Crystal Structure Of Unphosphorelated Receiver Domain Of Yycf Length = 120 Back     alignment and structure
>gi|126031093|pdb|2JB9|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D10a And D53e. Length = 127 Back     alignment and structure
>gi|254220896|pdb|2ZWM|A Chain A, Crystal Structure Of Yycf Receiver Domain From Bacillus Subtilis Length = 130 Back     alignment and structure
>gi|294979306|pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 Back     alignment and structure
>gi|294979306|pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 Back     alignment and structure
gi|251836870|pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-Response Regulator Complex Reveals Insights Into Two-Component Signaling And A Novel Cis-Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>gi|262118598|pdb|3GL9|A Chain A, The Structure Of A Histidine Kinase-Response Regulator Complex Sheds Light Into Two-Component Signaling And Reveals A Novel Cis Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>gi|27065585|pdb|1M5T|A Chain A, Crystal Structure Of The Response Regulator Divk Length = 124 Back     alignment and structure
>gi|56966618|pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-Digmp Length = 459 Back     alignment and structure
>gi|56966618|pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-Digmp Length = 459 Back     alignment and structure
>gi|158429258|pdb|2OQR|A Chain A, The Structure Of The Response Regulator Regx3 From Mycobacterium Tuberculosis Length = 230 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target123 two component response regulator [Candidatus Liberibact
1mb3_A124 Cell division response regulator DIVK; signal transduct 8e-29
1w25_A 459 Stalked-cell differentiation controlling protein; two-c 4e-26
1w25_A 459 Stalked-cell differentiation controlling protein; two-c 2e-09
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA h 3e-24
3nhm_A133 Response regulator; protein structure initiative II(PSI 3e-24
3lte_A132 Response regulator; structural genomics, PSI, protein s 2e-23
3f6p_A120 Transcriptional regulatory protein YYCF; unphosphorelat 2e-23
3eq2_A 394 Probable two-component response regulator; adaptor sigm 8e-23
3i42_A127 Response regulator receiver domain protein (CHEY- like) 8e-23
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A {Esch 9e-23
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cy 2e-22
3kht_A144 Response regulator; PSI-II, structural genomics, protei 1e-21
3bre_A 358 Probable two-component response regulator; protein-nucl 1e-21
2ayx_A254 Sensor kinase protein RCSC; two independent structural 1e-21
2zwm_A130 Transcriptional regulatory protein YYCF; two-component 2e-21
1k66_A149 Phytochrome response regulator RCPB; CHEY homologue, ho 2e-21
1k68_A140 Phytochrome response regulator RCPA; phosphorylated asp 3e-21
3b2n_A133 Uncharacterized protein Q99UF4; structural genomics, PS 6e-21
3lua_A140 Response regulator receiver protein; two-component sign 1e-20
1srr_A124 SPO0F, sporulation response regulatory protein; asparta 1e-20
1p6q_A129 CHEY2; chemotaxis, signal transduction, response regula 1e-20
1i3c_A149 Response regulator RCP1; phytochrome, signaling protein 2e-20
3f6c_A134 Positive transcription regulator EVGA; structural genom 3e-20
3hdg_A137 Uncharacterized protein; two-component sensor activity, 3e-20
1mvo_A136 PHOP response regulator; phosphate regulon, transcripti 3e-20
1dz3_A130 Stage 0 sporulation protein A; response regulator, doma 5e-20
3gl9_A122 Response regulator; beta-sheet, surrounded by alpha hel 1e-19
3cnb_A143 DNA-binding response regulator, MERR family; signal rec 4e-19
3kyj_B145 CHEY6 protein, putative histidine protein kinase; prote 4e-19
3eul_A152 Possible nitrate/nitrite response transcriptional regul 7e-19
3c97_A140 Signal transduction histidine kinase; structural genomi 7e-19
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGXRC, s 8e-19
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer, sig 1e-18
3grc_A140 Sensor protein, kinase; protein structure initiative II 2e-18
1s8n_A205 Putative antiterminator; structural genomics, transcrip 2e-18
1dcf_A136 ETR1 protein; beta-alpha five sandwich; 2.50A {Arabidop 2e-18
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional regula 3e-18
2jba_A127 Phosphate regulon transcriptional regulatory protein PH 3e-18
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain, pho 3e-18
3n0r_A286 Response regulator; sigma factor, receiver, two-compone 4e-18
3cu5_A141 Two component transcriptional regulator, ARAC family; s 4e-18
2j48_A119 Two-component sensor kinase; pseudo-receiver, circadian 4e-18
3heb_A152 Response regulator receiver domain protein (CHEY); NYSG 6e-18
3hdv_A136 Response regulator; PSI-II, structural genomics, protei 7e-18
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 activa 7e-18
2qsj_A154 DNA-binding response regulator, LUXR family; structural 9e-18
2zay_A147 Response regulator receiver protein; structural genomic 2e-17
3cz5_A153 Two-component response regulator, LUXR family; structur 2e-17
3cg4_A142 Response regulator receiver domain protein (CHEY- like) 3e-17
2gkg_A127 Response regulator homolog; social motility, receiver d 3e-17
3luf_A259 Two-component system response regulator/ggdef domain pr 3e-17
3kto_A136 Response regulator receiver protein; PSI-II,structural 3e-17
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatase, co 4e-17
2qv0_A143 Protein MRKE; structural genomics, transcription, PSI-2 5e-17
2b4a_A138 BH3024; 10175646, structural genomics, joint center for 6e-17
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptation, 6e-17
3eqz_A135 Response regulator; structural genomics, unknown functi 8e-17
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, struc 9e-17
3a10_A116 Response regulator; phosphoacceptor, signaling protein; 1e-16
3c3m_A138 Response regulator receiver protein; structural genomic 1e-16
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPase, s 1e-16
2a9o_A120 Response regulator; essential protein, YYCF/YYCG homolo 3e-16
3eod_A130 Protein HNR; response regulator, phosphoprotein, two-co 4e-16
3cg0_A140 Response regulator receiver modulated diguanylate cycla 6e-16
3cfy_A137 Putative LUXO repressor protein; structural genomics, u 1e-15
3gt7_A154 Sensor protein; structural genomics, signal receiver do 9e-15
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5-BETA5 1e-14
2qxy_A142 Response regulator; regulation of transcription, NYSGXR 1e-14
1zh2_A121 KDP operon transcriptional regulatory protein KDPE; two 2e-14
2jk1_A139 HUPR, hydrogenase transcriptional regulatory protein HU 2e-14
2qr3_A140 Two-component system response regulator; structural gen 3e-14
3h5i_A140 Response regulator/sensory box protein/ggdef domain pro 4e-14
2rjn_A154 Response regulator receiver:metal-dependent phosphohydr 7e-14
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, prot 1e-13
3crn_A132 Response regulator receiver domain protein, CHEY- like; 1e-13
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural genom 2e-13
1zgz_A122 Torcad operon transcriptional regulatory protein TORR; 4e-13
3cwo_X 237 Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, 7e-13
1xhf_A123 DYE resistance, aerobic respiration control protein ARC 7e-13
2qzj_A136 Two-component response regulator; 11017X, PSI-II, struc 8e-13
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wound f 9e-13
2rdm_A132 Response regulator receiver protein; structural genomic 1e-12
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like fold 1e-12
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2.25A 2e-11
3klo_A225 Transcriptional regulator VPST; REC domain, HTH domain, 2e-11
2gwr_A 238 DNA-binding response regulator MTRA; two-component regu 4e-11
1kgs_A 225 DRRD, DNA binding response regulator D; DNA-binding pro 3e-10
2oqr_A 230 Sensory transduction protein REGX3; response regulator, 3e-10
1p2f_A 220 Response regulator; DRRB, OMPR/PHOB, transcription; HET 4e-10
1yio_A208 Response regulatory protein; transcription regulation, 9e-10
3jte_A143 Response regulator receiver protein; structural genomic 1e-09
2pln_A137 HP1043, response regulator; signaling protein; 1.80A {H 6e-08
1ys7_A 233 Transcriptional regulatory protein PRRA; response regul 1e-07
1a04_A215 Nitrate/nitrite response regulator protein NARL; signal 1e-05
3luf_A 259 Two-component system response regulator/ggdef domain pr 1e-10
3c3w_A 225 Two component transcriptional regulatory protein DEVR; 6e-08
2hqr_A 223 Putative transcriptional regulator; phosporylation-inde 5e-06
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
 Score =  120 bits (303), Expect = 8e-29
 Identities = 85/118 (72%), Positives = 102/118 (86%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IVEDNELNMKLF DL+E  GY  LQTR G+ AL +AR++KPD+I+MDIQL EISGL
Sbjct: 2   KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGL 61

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+TK +KED +L  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK+ +
Sbjct: 62  EVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLL 119
>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* Length = 459 Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, nysgrc, NEW YORK structural genomix research consortium; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} Length = 394 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 1cye_A 2che_A 2chf_A 2pl9_A* 2pmc_A ... Length = 128 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>3kht_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Hahella chejuensis kctc 2396} Length = 144 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa PAO1} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>2zwm_A Transcriptional regulatory protein YYCF; two-component system, response regulator, dimerization domain, phosphorylation site, cytoplasm; 2.04A {Bacillus subtilis} Length = 130 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, , PSI-2, protein structure initiative; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structure initiative, PSI-2; 2.00A {Colwellia psychrerythraea 34H} Length = 143 Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>1s8n_A Putative antiterminator; structural genomics, transcriptional antiterminator, two component system, PSI; 1.48A {Mycobacterium tuberculosis H37RV} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory protein PHOB; transcription factor, sensory transduction, phosphate regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} Length = 286 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC family; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, protein structure initiative; 2.40A {Rhodospirillum rubrum atcc 11170} Length = 152 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.09A {Pseudomonas putida KT2440} Length = 136 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, PSI-2, protein structure initiative; 2.00A {Desulfuromonas acetoxidans dsm 684} Length = 147 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY- like); structural genomics, unknown function, uncharacterized protein; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolution, signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 Back     alignment and structure
>2b4a_A BH3024; 10175646, structural genomics, joint center for structural genomics, JCSG, protein structure initiative PSI, unknown function; 2.42A {Bacillus halodurans c-125} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.15A {Colwellia psychrerythraea 34H} Length = 135 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, dimer; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 1zy2_A* Length = 387 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor; signal receiver domain; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HUPR1; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structure initiative; 1.80A {Bacteroides fragilis YCH46} Length = 140 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92, PSI-2; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein structure initiative, structural genomics; 2.59A {Cytophaga hutchinsonii atcc 33406} Length = 146 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY- like; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein TORR; two-component system, gene regulation, transcription factor, TMAO respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} Length = 237 Back     alignment and structure