254780477

254780477

DSBA oxidoreductase

GeneID in NCBI database:8209466Locus tag:CLIBASIA_01810
Protein GI in NCBI database:254780477Protein Accession:YP_003064890.1
Gene range:-(399166, 399864)Protein Length:232aa
Gene description:DSBA oxidoreductase
COG prediction:[O] Protein-disulfide isomerase
KEGG prediction:DsbA oxidoreductase
SEED prediction:Periplasmic thiol:disulfide interchange protein DsbA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Biogenesis of c-type cytochromes;
Periplasmic disulfide interchange
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
cEEEEHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccHHHHHHccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccEEEEccEEEcccccHHHHHHHHHHHHHHHHcc
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHcHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEccEEccccccHHHHHHHHHHHHHHHccc
MVMSTTRIGVLGGIVLLFIASYFFYtrkgsalnelpipdgvVDFRALLaaspstmkdvsigqkdapvTMVEYASMTCFHCAEFHNKTFKYLEDkyiktgklryilrefpldsVSTVAVMLARCAEKRMDGGYWGFVSLLFNkqddwinsKNYRDALLNMAKfagfskndfdtclndqnILDDIKAGkkrasedfaidstpvffiggnlylgdmsegVFSKIIDSMIQDSTRR
mvmsttrigvLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAAspstmkdvsigQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIlrefpldsvSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRasedfaidstpVFFIGGNLYLGDMSEGVFSKIIdsmiqdstrr
MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
***STTRIGVLGGIVLLFIASYFFYT*********************************IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS*IQ*****
MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
*VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST**
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target232 DSBA oxidoreductase [Candidatus Liberibacter asiaticus
315122067228 DSBA oxidoreductase [Candidatus Liberibacter solanacear 1 2e-84
227821137268 putative disulfide bond formation protein D [Sinorhizob 1 1e-51
150395769269 DSBA oxidoreductase [Sinorhizobium medicae WSM419] Leng 1 3e-51
15888143226 hypothetical protein Atu0800 [Agrobacterium tumefaciens 1 3e-51
15964683269 hypothetical protein SMc00023 [Sinorhizobium meliloti 1 1 1e-50
325292182226 disulfide bond formation protein D [Agrobacterium sp. H 1 2e-48
110633124229 DSBA oxidoreductase [Mesorhizobium sp. BNC1] Length = 2 1 7e-47
260460275247 DSBA oxidoreductase [Mesorhizobium opportunistum WSM207 1 1e-46
163760360251 hypothetical protein HPDFL43_03616 [Hoeflea phototrophi 1 1e-46
86356645259 putative thiol-disulfide oxidoreductase protein [Rhizob 1 5e-46
>gi|315122067|ref|YP_004062556.1| DSBA oxidoreductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 228 Back     alignment and organism information
 Score =  315 bits (808), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 152/225 (67%), Positives = 184/225 (81%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M T +IG L   V+  + S FFYT+  ++ N LP+P  ++D   LLAASP  M+++SIG+
Sbjct: 1   MKTAKIGALCIAVVFVVGSVFFYTKSRNSSNALPLPYSMIDVDILLAASPHAMEEISIGR 60

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           +DAP+T+VEYASMTCFHCAEFHNKTFK +EDKYIKTGK+R+I REFPLDSVST A MLAR
Sbjct: 61  QDAPLTIVEYASMTCFHCAEFHNKTFKKIEDKYIKTGKVRFIFREFPLDSVSTAASMLAR 120

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           CAE R+ GGY+GFVS+LF KQ+DWI SKNYR+++ NMAK AGFS+NDFD+CL +Q+ILDD
Sbjct: 121 CAENRVKGGYFGFVSMLFKKQNDWIESKNYRESMFNMAKIAGFSRNDFDSCLGNQSILDD 180

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           IK G K A E   I+STP FFIGGNLYLGDMSE VFSKIIDSMI+
Sbjct: 181 IKTGNKIAVEKLLINSTPSFFIGGNLYLGDMSEEVFSKIIDSMIE 225



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821137|ref|YP_002825107.1| putative disulfide bond formation protein D [Sinorhizobium fredii NGR234] Length = 268 Back     alignment and organism information
>gi|150395769|ref|YP_001326236.1| DSBA oxidoreductase [Sinorhizobium medicae WSM419] Length = 269 Back     alignment and organism information
>gi|15888143|ref|NP_353824.1| hypothetical protein Atu0800 [Agrobacterium tumefaciens str. C58] Length = 226 Back     alignment and organism information
>gi|15964683|ref|NP_385036.1| hypothetical protein SMc00023 [Sinorhizobium meliloti 1021] Length = 269 Back     alignment and organism information
>gi|325292182|ref|YP_004278046.1| disulfide bond formation protein D [Agrobacterium sp. H13-3] Length = 226 Back     alignment and organism information
>gi|110633124|ref|YP_673332.1| DSBA oxidoreductase [Mesorhizobium sp. BNC1] Length = 229 Back     alignment and organism information
>gi|260460275|ref|ZP_05808527.1| DSBA oxidoreductase [Mesorhizobium opportunistum WSM2075] Length = 247 Back     alignment and organism information
>gi|163760360|ref|ZP_02167442.1| hypothetical protein HPDFL43_03616 [Hoeflea phototrophica DFL-43] Length = 251 Back     alignment and organism information
>gi|86356645|ref|YP_468537.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli CFN 42] Length = 259 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target232 DSBA oxidoreductase [Candidatus Liberibacter asiaticus
cd03023154 cd03023, DsbA_Com1_like, DsbA family, Com1-like subfami 6e-09
COG1651244 COG1651, DsbG, Protein-disulfide isomerase [Posttransla 7e-21
cd0297298 cd02972, DsbA_family, DsbA family; consists of DsbA and 6e-04
>gnl|CDD|48572 cd03023, DsbA_Com1_like, DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>gnl|CDD|31837 COG1651, DsbG, Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|73335 cd02972, DsbA_family, DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 232 DSBA oxidoreductase [Candidatus Liberibacter asiaticus
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; compos 99.97
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monome 99.96
PRK10954207 periplasmic protein disulfide isomerase I; Provisional 99.89
COG1651244 DsbG Protein-disulfide isomerase [Posttranslational mod 99.89
pfam01323191 DSBA DSBA-like thioredoxin domain. This family contains 99.75
COG2761225 FrnE Predicted dithiol-disulfide isomerase involved in 99.72
cd03024201 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-l 99.72
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V- 99.59
PRK10877232 thiol:disulfide interchange protein DsbC; Provisional 99.5
PRK11657253 dsbG disulfide isomerase/thiol-disulfide oxidase; Provi 99.46
cd03025193 DsbA_FrnE_like DsbA family, FrnE-like subfamily; compos 99.44
cd03022192 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxyl 99.4
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA-like 99.36
COG3917203 NahD 2-hydroxychromene-2-carboxylate isomerase [Seconda 98.84
cd03021209 DsbA_GSTK DsbA family, Glutathione (GSH) S-transferase 98.58
PRK03147176 thiol-disulfide oxidoreductase; Provisional 98.49
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical protei 98.04
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was origina 98.0
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reductase ( 97.91
KOG0910150 consensus 97.08
KOG3160220 consensus 96.57
COG3531212 Predicted protein-disulfide isomerase [Posttranslationa 98.4
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, 98.02
PRK10996139 thioredoxin 2; Provisional 97.95
PRK09381109 trxA thioredoxin; Provisional 97.87
pfam00085104 Thioredoxin Thioredoxin. Thioredoxins are small enzymes 97.69
COG2143182 Thioredoxin-related protein [Posttranslational modifica 97.68
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of euk 97.52
cd0294793 TRX_family TRX family; composed of two groups: Group I, 97.39
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of prote 97.33
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed of pro 97.18
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-termin 97.12
TIGR0041182 redox_disulf_1 redox-active disulfide protein 1; InterP 97.03
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 96.82
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) family, 96.79
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryo 96.64
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 96.53
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protein fam 96.47
TIGR01126107 pdi_dom protein disulfide-isomerase domain; InterPro: I 96.37
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') 96.16
COG069580 GrxC Glutaredoxin and related proteins [Posttranslation 94.93
TIGR01068101 thioredoxin thioredoxin; InterPro: IPR005746 Thioredoxi 93.71
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; 93.61
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; 93.48
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 93.37
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulum pro 93.34
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; compos 93.0
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide red 92.44
TIGR02187237 GlrX_arch Glutaredoxin-like domain protein; InterPro: I 92.4
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin 92.32
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion p 92.05
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 90.46
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like 90.38
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monome 90.32
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetic 97.03
PTZ00102 479 disulphide isomerase; Provisional 96.92
PTZ0005198 thioredoxin; Provisional 96.45
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, Try 95.99
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfami 95.94
cd02966116 TlpA_like_family TlpA-like family; composed of TlpA, Re 95.85
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; compo 95.81
TIGR01130 522 ER_PDI_fam protein disulfide isomerases; InterPro: IPR0 95.72
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (AP 95.57
COG3118304 Thioredoxin domain-containing protein [Posttranslationa 95.51
PRK13728181 conjugal transfer protein TrbB; Provisional 95.48
TIGR01130522 ER_PDI_fam protein disulfide isomerases; InterPro: IPR0 95.1
KOG1731 606 consensus 94.91
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for 94.87
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QS 94.85
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-de 94.77
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known as Cc 93.84
KOG0190 493 consensus 92.44
cd02967114 mauD Methylamine utilization (mau) D family; mauD prote 92.06
TIGR02738176 TrbB type-F conjugative transfer system pilin assembly 91.86
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induced st 91.05
TIGR0041182 redox_disulf_1 redox-active disulfide protein 1; InterP 90.12
PTZ00102 479 disulphide isomerase; Provisional 92.9
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam01323 DSBA DSBA-like thioredoxin domain Back     alignment and domain information
>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PRK10877 thiol:disulfide interchange protein DsbC; Provisional Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE Back     alignment and domain information
>cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>COG3917 NahD 2-hydroxychromene-2-carboxylate isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03021 DsbA_GSTK DsbA family, Glutathione (GSH) S-transferase Kappa (GSTK) subfamily; GSTK is a member of the GST family of enzymes which catalyzes the transfer of the thiol of GSH to electrophilic substrates Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>KOG0910 consensus Back     alignment and domain information
>KOG3160 consensus Back     alignment and domain information
>COG3531 Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>pfam00085 Thioredoxin Thioredoxin Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>TIGR00411 redox_disulf_1 redox-active disulfide protein 1; InterPro: IPR004502 This group of proteins includes thioredoxins, glutaredoxins, protein-disulphide isomerases, and others, some of which have several such domains Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain; InterPro: IPR005788 This is a domain of eukaryotic protein disulphide isomerases, generally found in two copies Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin; InterPro: IPR005746 Thioredoxins , , , are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein; InterPro: IPR011903 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms Back     alignment and domain information
>KOG1731 consensus Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>KOG0190 consensus Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB; InterPro: IPR014109 This entry includes thiol-disulphide isomerase (TrbB), a protein that is involved in conjugative transfer of plasmid DNA, specifically in the F-type system Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>TIGR00411 redox_disulf_1 redox-active disulfide protein 1; InterPro: IPR004502 This group of proteins includes thioredoxins, glutaredoxins, protein-disulphide isomerases, and others, some of which have several such domains Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target232 DSBA oxidoreductase [Candidatus Liberibacter asiaticus
3eu3_A202 Crystal Structure Of Bdbd From Bacillus Subtilis (R 6e-20
3f4r_A226 Crystal Structure Of Wolbachia Pipientis Alpha-Dsba 8e-15
3f4s_A226 Crystal Structure Of Wolbachia Pipientis Alpha-Dsba 4e-14
3gyk_A175 The Crystal Structure Of A Thioredoxin-Like Oxidore 6e-14
3f4t_A226 Crystal Structure Of Wolbachia Pipientis Alpha-Dsba 2e-13
3bd2_A186 Crystal Structure Of Staphylococcus Aureus Dsba E96 2e-11
3bci_A186 Crystal Structure Of Staphylococcus Aureus Dsba Len 2e-11
3gmf_A205 Crystal Structure Of Protein-Disulfide Isomerase Fr 7e-11
3bck_A186 Crystal Structure Of Staphylococcus Aureus Dsba T15 1e-10
3h93_A192 Crystal Structure Of Pseudomonas Aeruginosa Dsba Le 8e-09
3dvw_A193 Crystal Structure Of Reduced Dsba1 From Neisseria M 2e-08
3a3t_A210 The Oxidoreductase Nmdsba1 From N. Meningitidis Len 2e-08
2rem_A193 Crystal Structure Of Oxidoreductase Dsba From Xylel 4e-08
3hz8_A193 Crystal Structure Of The Oxidized T176v Dsba1 Mutan 8e-08
1z6m_A175 Structure Of Conserved Protein Of Unknown Function 3e-07
3hd5_A195 Crystal Structure Of A Thiol:disulfide Interchange 4e-07
2ijy_A181 Nmr Structure Ensemble For The Reduced Dsba Disulph 1e-06
1bed_A181 Structure Of Disulfide Oxidoreductase Length = 181 1e-06
3feu_A185 Crystal Structure Of Dsba-Like Thioredoxin Domain V 4e-06
3l9u_A201 Crystal Structure Of Salmonella Enterica Serovar Ty 4e-05
3l9v_A189 Crystal Structure Of Salmonella Enterica Serovar Ty 4e-05
3dks_A189 Dsba Substrate Complex Length = 189 5e-05
1dsb_A189 Crystal Structure Of The Dsba Protein Required For 5e-05
1fvj_A189 The 2.06 Angstrom Structure Of The H32y Mutant Of T 6e-05
3l9s_A191 Crystal Structure Of Salmonella Enterica Serovar Ty 1e-04
2znm_A195 Oxidoreductase Nmdsba3 From Neisseria Meningitidis 1e-04
3c7m_A195 Crystal Structure Of Reduced Dsbl Length = 195 1e-04
3dvx_A196 Crystal Structure Of Reduced Dsba3 From Neisseria M 1e-04
1ti1_A189 Crystal Structure Of A Mutant Dsba Length = 189 2e-04
1acv_A189 Dsba Mutant H32s Length = 189 3e-04
1ac1_A189 Dsba Mutant H32l Length = 189 3e-04
2b3s_A189 Structure Of The Dsba Mutant (P31g-C33a) Length = 1 6e-04
2b6m_A189 Structure Of The Dsba Mutant (P31a-C33a) Length = 1 0.002
>gi|240104401|pdb|3EU3|A Chain A, Crystal Structure Of Bdbd From Bacillus Subtilis (Reduced) Length = 202 Back     alignment and structure 
 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 64/188 (34%), Gaps = 1/188 (0%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                  ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G 
Sbjct: 5   TEQGNDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGD 64

Query: 101 LRYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +++           +      +    K     +W F   LF KQ D          L ++
Sbjct: 65  VKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDL 124

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           AK     K +      D+             ++   I +TP  ++   +           
Sbjct: 125 AKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIK 184

Query: 220 KIIDSMIQ 227
           + I+  ++
Sbjct: 185 ETIEKELK 192
>gi|225734104|pdb|3F4R|A Chain A, Crystal Structure Of Wolbachia Pipientis Alpha-Dsba1 Length = 226 Back     alignment and structure
>gi|225734105|pdb|3F4S|A Chain A, Crystal Structure Of Wolbachia Pipientis Alpha-Dsba1 T172v Length = 226 Back     alignment and structure
>gi|239782029|pdb|3GYK|A Chain A, The Crystal Structure Of A Thioredoxin-Like Oxidoreductase From Silicibacter Pomeroyi Dss-3 Length = 175 Back     alignment and structure
>gi|225734106|pdb|3F4T|A Chain A, Crystal Structure Of Wolbachia Pipientis Alpha-Dsba1 C97aC146A Length = 226 Back     alignment and structure
>gi|162330238|pdb|3BD2|A Chain A, Crystal Structure Of Staphylococcus Aureus Dsba E96q Length = 186 Back     alignment and structure
>gi|162330236|pdb|3BCI|A Chain A, Crystal Structure Of Staphylococcus Aureus Dsba Length = 186 Back     alignment and structure
>gi|225734328|pdb|3GMF|A Chain A, Crystal Structure Of Protein-Disulfide Isomerase From Novosphingobium Aromaticivorans Length = 205 Back     alignment and structure
>gi|162330237|pdb|3BCK|A Chain A, Crystal Structure Of Staphylococcus Aureus Dsba T153v Length = 186 Back     alignment and structure
>gi|270346535|pdb|3H93|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Dsba Length = 192 Back     alignment and structure
>gi|255311760|pdb|3DVW|A Chain A, Crystal Structure Of Reduced Dsba1 From Neisseria Meningitidis Length = 193 Back     alignment and structure
>gi|261824770|pdb|3A3T|A Chain A, The Oxidoreductase Nmdsba1 From N. Meningitidis Length = 210 Back     alignment and structure
>gi|209156363|pdb|2REM|A Chain A, Crystal Structure Of Oxidoreductase Dsba From Xylella Fastidiosa Length = 193 Back     alignment and structure
>gi|256599851|pdb|3HZ8|A Chain A, Crystal Structure Of The Oxidized T176v Dsba1 Mutant Length = 193 Back     alignment and structure
>gi|66361337|pdb|1Z6M|A Chain A, Structure Of Conserved Protein Of Unknown Function From Enterococcus Faecalis V583 Length = 175 Back     alignment and structure
>gi|237824100|pdb|3HD5|A Chain A, Crystal Structure Of A Thiol:disulfide Interchange Protein Dsba From Bordetella Parapertussis Length = 195 Back     alignment and structure
>gi|152149114|pdb|2IJY|A Chain A, Nmr Structure Ensemble For The Reduced Dsba Disulphide Oxidoreductase From Vibrio Cholerae Length = 181 Back     alignment and structure
>gi|157830252|pdb|1BED|A Chain A, Structure Of Disulfide Oxidoreductase Length = 181 Back     alignment and structure
>gi|221046835|pdb|3FEU|A Chain A, Crystal Structure Of Dsba-Like Thioredoxin Domain Vf_a0457 From Vibrio Fischeri Length = 185 Back     alignment and structure
>gi|290790202|pdb|3L9U|A Chain A, Crystal Structure Of Salmonella Enterica Serovar Typhimurium Dsbl Length = 201 Back     alignment and structure
>gi|290790203|pdb|3L9V|A Chain A, Crystal Structure Of Salmonella Enterica Serovar Typhimurium Srga Length = 189 Back     alignment and structure
>gi|237640481|pdb|3DKS|A Chain A, Dsba Substrate Complex Length = 189 Back     alignment and structure
>gi|493982|pdb|1DSB|A Chain A, Crystal Structure Of The Dsba Protein Required For Disulphide Bond Formation In Vivo Length = 189 Back     alignment and structure
>gi|2194076|pdb|1FVJ|A Chain A, The 2.06 Angstrom Structure Of The H32y Mutant Of The Disulfide Bond Formation Protein (Dsba) Length = 189 Back     alignment and structure
>gi|290790201|pdb|3L9S|A Chain A, Crystal Structure Of Salmonella Enterica Serovar Typhimurium Dsba Length = 191 Back     alignment and structure
>gi|197107213|pdb|2ZNM|A Chain A, Oxidoreductase Nmdsba3 From Neisseria Meningitidis Length = 195 Back     alignment and structure
>gi|194320016|pdb|3C7M|A Chain A, Crystal Structure Of Reduced Dsbl Length = 195 Back     alignment and structure
>gi|255311761|pdb|3DVX|A Chain A, Crystal Structure Of Reduced Dsba3 From Neisseria Meningitidis Length = 196 Back     alignment and structure
>gi|66360168|pdb|1TI1|A Chain A, Crystal Structure Of A Mutant Dsba Length = 189 Back     alignment and structure
>gi|2624857|pdb|1ACV|A Chain A, Dsba Mutant H32s Length = 189 Back     alignment and structure
>gi|2624855|pdb|1AC1|A Chain A, Dsba Mutant H32l Length = 189 Back     alignment and structure
>gi|114793506|pdb|2B3S|A Chain A, Structure Of The Dsba Mutant (P31g-C33a) Length = 189 Back     alignment and structure
>gi|118137311|pdb|2B6M|A Chain A, Structure Of The Dsba Mutant (P31a-C33a) Length = 189 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target232 DSBA oxidoreductase [Candidatus Liberibacter asiaticus
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-like, TR 6e-27
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thioredo 1e-24
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidoreductas 6e-24
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfide bon 2e-21
1z6m_A175 Conserved hypothetical protein; structural genomics, MC 6e-21
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2, NYS 9e-20
3gyk_A175 27KDA outer membrane protein; APC61738.2, thioredoxin-l 1e-19
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, struct 2e-19
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase, DSB 1e-17
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein struc 4e-17
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; thio 2e-16
3c7m_A195 Thiol:disulfide interchange protein DSBA-like; redox pr 4e-16
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-oxidore 5e-16
3feu_A185 Putative lipoprotein; alpha-beta structure, structural 2e-15
3l9s_A191 Thiol:disulfide interchange protein DSBA; thioredoxin-f 5e-15
1bed_A181 DSBA oxidoreductase; TCPG, protein disulfide isomerase, 2e-14
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredoxin f 4e-14
1acv_A189 DSBA; disulfide oxidoreductase, thioredoxin fold, redox 3e-13
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced DSBG, 1e-08
1eej_A216 Thiol:disulfide interchange protein; oxidoreductase, pr 2e-08
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoeae (s 4e-05
1un2_A 197 DSBA, thiol-disulfide interchange protein; disulfide ox 4e-04
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Length = 202 Back     alignment and structure
 Score =  116 bits (290), Expect = 6e-27
 Identities = 33/182 (18%), Positives = 66/182 (36%), Gaps = 3/182 (1%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G +++    
Sbjct: 12  VSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVN 71

Query: 108 FPLD-SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA-KFAGF 165
                  S +A + +    K     +W F   LF KQ D          L ++A      
Sbjct: 72  VMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKI 131

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
                   L+ +     ++       +   I +TP  ++   +           + I+  
Sbjct: 132 KPETLKENLDKETFASQVEKDSDLN-QKMNIQATPTIYVNDKVIKNFADYDEIKETIEKE 190

Query: 226 IQ 227
           ++
Sbjct: 191 LK 192
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis wmel} PDB: 3f4r_A* 3f4t_A* Length = 226 Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Length = 186 Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, periplasm, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} Length = 192 Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, PSI, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis V583} SCOP: c.47.1.13 Length = 175 Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans DSM12444} Length = 205 Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, thioredoxin-like, oxidoreductase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.76A {Silicibacter pomeroyi dss-3} Length = 175 Back     alignment and structure
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural genomics, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 182 Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Length = 193 Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Length = 195 Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, plasmid, oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} Length = 189 Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} Length = 195 Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A Length = 193 Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio fischeri ES114} Length = 185 Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein DSBA; thioredoxin-fold, thiol-disulfide oxidoreductase, disulfide bond, periplasm; 1.58A {Salmonella enterica subsp} PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Length = 191 Back     alignment and structure
>1bed_A DSBA oxidoreductase; TCPG, protein disulfide isomerase, disulfide oxidoreductase; 2.00A {Vibrio cholerae} SCOP: c.47.1.13 PDB: 2ijy_A Length = 181 Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Length = 195 Back     alignment and structure
>1acv_A DSBA; disulfide oxidoreductase, thioredoxin fold, redox-active center; 1.90A {Escherichia coli} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 1ac1_A 1fvj_A 3dks_A 1bq7_A 1u3a_A* 1ti1_A* 2hi7_A* 2zup_A* 3e9j_B* 2b6m_A 2b3s_A Length = 189 Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Length = 241 Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Length = 216 Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain ATCC 700825 / FA 1090), DSBC, structural genomics, unknown function; 2.00A {Neisseria gonorrhoeae fa 1090} Length = 147 Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Length = 197 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target232 DSBA oxidoreductase [Candidatus Liberibacter asiaticus
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thioredo 100.0
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-like, TR 100.0
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidoreductas 99.97
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2, NYS 99.97
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein struc 99.97
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfide bon 99.96
3gyk_A175 27KDA outer membrane protein; APC61738.2, thioredoxin-l 99.96
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase, DSB 99.96
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-oxidore 99.96
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredoxin f 99.95
1z6m_A175 Conserved hypothetical protein; structural genomics, MC 99.94
1bed_A181 DSBA oxidoreductase; TCPG, protein disulfide isomerase, 99.94
3c7m_A195 Thiol:disulfide interchange protein DSBA-like; redox pr 99.94
3feu_A185 Putative lipoprotein; alpha-beta structure, structural 99.93
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; thio 99.93
3l9s_A191 Thiol:disulfide interchange protein DSBA; thioredoxin-f 99.92
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, struct 99.9
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced DSBG, 99.81
1eej_A216 Thiol:disulfide interchange protein; oxidoreductase, pr 99.8
2in3_A216 Hypothetical protein; DSBA family, FRNE-like subfamily, 99.77
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidoreductas 99.76
3gl5_A239 Putative DSBA oxidoreductase SCO1869; probable DSBA oxi 99.75
3kzq_A208 Putative uncharacterized protein VP2116; protein with u 99.75
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoeae (s 99.74
2imf_A203 HCCA isomerase, 2-hydroxychromene-2-carboxylate isomera 99.57
3fz5_A202 Possible 2-hydroxychromene-2-carboxylate isomerase; str 99.51
1r4w_A226 Glutathione S-transferase, mitochondrial; glutathione t 99.37
1yzx_A226 Glutathione S-transferase kappa 1; glutathione sulfinat 99.37
3dml_A116 Putative uncharacterized protein; thioredoxin, oxidored 98.62
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, structural 98.33
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural genom 98.21
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, riken 98.04
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreductase; N 98.03
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 97.95
1nsw_A105 Thioredoxin, TRX; thermostability, electron transport; 97.83
3or5_A165 Thiol:disulfide interchange protein, thioredoxin protei 97.68
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; oxid 97.53
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomics, PS 97.47
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, PSI, M 97.45
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin protein, P 97.33
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductase MSR 97.31
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-like p 97.21
2vup_A190 Glutathione peroxidase-like protein; oxidoreductase, tr 97.17
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3-laye 97.03
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thiol-th 96.39
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfide ox 99.1
1un2_A 197 DSBA, thiol-disulfide interchange protein; disulfide ox 99.07
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxidored 98.3
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disulfide 98.19
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protein str 98.17
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus toko 98.09
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold; 1.9 98.06
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; struc 98.06
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichia col 98.05
3gnj_A111 Thioredoxin domain protein; APC92103, structural genomi 98.04
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bacteroid 98.03
2l57_A126 Uncharacterized protein; structural genomics, unknown f 98.0
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mitocho 97.96
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, PSI-2 97.94
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, redo 97.9
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxidoredu 97.9
1t00_A112 Thioredoxin, TRX; structure, redox regulation, multifun 97.87
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); splicing, 97.86
2ywm_A229 Glutaredoxin-like protein; redox protein, structural ge 97.85
1zma_A118 Bacterocin transport accessory protein; alpha-beta-alph 97.84
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, 97.84
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredoxin f 97.83
2yzu_A109 Thioredoxin; redox protein, electron transport, structu 97.83
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxidoreduc 97.82
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ERP72, 97.82
2voc_A112 Thioredoxin; electron transport, homodimer, disulfide, 97.81
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia oler 97.81
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta protein, 97.8
1gh2_A107 Thioredoxin-like protein; redox-active center, electron 97.76
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, chlorop 97.75
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase and th 97.75
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, electron t 97.74
2kuc_A130 Putative disulphide-isomerase; structural genomics, thi 97.71
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electron tr 97.66
2diz_A117 Thioredoxin domain-containing protein 5; thioredoxin-li 97.66
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredoxin-l 97.66
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI, pro 97.64
1r26_A125 Thioredoxin; redox-active disulfide, electron transport 97.62
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron transp 97.6
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, 97.57
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} P 97.56
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, th 97.55
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A {Chl 97.54
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, protein 97.5
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross-reac 97.5
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cytoplas 97.5
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidoreductas 97.48
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomics, AP 97.47
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 97.45
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-terminal th 97.45
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like supe 97.41
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain-cont 97.41
2qsi_A137 Putative hydrogenase expression/formation protein HUPG; 97.4
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.3 97.4
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin fold 97.37
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXNDC1, s 97.3
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia oler 97.3
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tr 97.29
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, 97.23
1mek_A120 Protein disulfide isomerase; electron transport, redox- 97.18
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-protein 97.15
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, protein st 97.15
3f9u_A172 Putative exported cytochrome C biogenesis- related prot 97.12
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytoplasm, 97.05
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide reducta 96.98
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sandwich, 96.97
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like fold, 96.95
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreductase, P 96.9
1x5c_A121 Protein disulfide-isomerase; DSI, ERBA2L, GIT, PDI, PDI 96.86
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-beta fo 96.78
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like fold, 96.76
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulation, d 96.71
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ERP72, 96.7
1wmj_A130 Thioredoxin H-type; structural genomics, program for RI 96.44
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, cytoplasm, o 96.32
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cytoplas 96.24
3cxg_A133 Putative thioredoxin; malaria, structural genomics, oxi 96.22
2rli_A171 SCO2 protein homolog, mitochondrial; copper protein, th 96.02
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX6, ox 95.98
2dlx_A153 UBX domain-containing protein 7; UAS domain, protein KI 95.29
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, antibod 94.97
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia coli 94.88
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, p 92.83
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for structu 92.48
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold; NMR 92.45
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha-beta- 92.19
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaperone, 91.96
3h79_A127 Thioredoxin-like protein; thioredoxin fold, catalytic c 91.24
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, protein 91.15
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin fold, 91.0
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron transp 90.53
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thioredox 97.55
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS motif, ch 97.55
1xwb_A106 Thioredoxin; dimerization, redox regulation, X-RAY elec 97.53
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredoxin-l 97.44
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like doma 97.25
3f8u_A 481 Protein disulfide-isomerase A3ERP57; alternative splici 97.24
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, structu 97.19
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like, thi 97.14
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; redox p 97.03
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCSG, st 97.02
1wou_A123 Thioredoxin -related protein, 14 kDa; electron transpor 96.98
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , stru 96.92
2ywi_A196 Hypothetical conserved protein; uncharacterized conserv 96.92
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like fold, 96.9
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomonas vag 96.48
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved protein, 96.39
3cyn_A189 Probable glutathione peroxidase 8; thioredoxin fold, me 96.32
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, thior 96.31
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, oxido 95.9
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidoreduct 95.88
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, NPGP 95.19
3fk8_A133 Disulphide isomerase; APC61824.1, structural genomics, 95.06
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin fold 93.92
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces cerev 92.83
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, trans 92.08
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold; 1.9 90.9
3me7_A170 Putative uncharacterized protein; electron transfer pro 90.69
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) sand 90.03
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis wmel} PDB: 3f4r_A* 3f4t_A* Back     alignment and structure
Probab=100.00  E-value=9.1e-34  Score=232.05  Aligned_cols=175  Identities=33%  Similarity=0.608  Sum_probs=151.9

Q ss_pred             CCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66784116898888999970588820644334211344320000203799843323430245777666666665321245
Q gi|254780477|r   54 TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYW  133 (232)
Q Consensus        54 ~~~~~~~G~~~A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~  133 (232)
                      ..+++++||+||||+|+||+||.||||+.|++++.+.+++.+.+.+++.+++++++.+.....++..+  .+...++++|
T Consensus        28 ~~~~~~~Gn~dA~i~Ivef~Dy~Cp~C~~f~~~v~~~l~~~~~~~~~~~~~~~~~p~~~~s~~aa~~a--~~a~~~~k~~  105 (226)
T 3f4s_A           28 LPNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLKAAMLS--HCYEKQEDYF  105 (226)
T ss_dssp             CTTCCEESCTTCSEEEEEEECTTCHHHHHHHHHTHHHHHHHHTTTTSEEEEEEECCCSHHHHHHHHHG--GGCCSHHHHH
T ss_pred             CCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHH--HHHHCCCCHH
T ss_conf             99998367999998999988999873798999999999998502652899846887646699999999--9874014258


Q ss_pred             HHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECC------
Q ss_conf             58888886543321134-56899876431100006889864059899999999999999861885365799898------
Q gi|254780477|r  134 GFVSLLFNKQDDWINSK-NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG------  206 (232)
Q Consensus       134 ~~~~~~~~~q~~~~~~~-~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~gi~gTPt~~VnG------  206 (232)
                      .+++.+|..|..+.... ...+.+..++...|++..++.+|+++....+.+.++...+.+++||+|||||||||      
T Consensus       106 ~~~~~Lf~~q~~~~~~~~~~~~~l~~~a~~~Gld~~~~~~~l~s~~~~~~v~~~~~~a~~~~gI~gTPtfiIng~~~~~~  185 (226)
T 3f4s_A          106 NFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINKLGITAVPIFFIKLNDDKSY  185 (226)
T ss_dssp             HHHHHHHHTGGGSCSSSTTCCHHHHHHHHHTTCCHHHHHHHHTCHHHHHHHHHHHHHHHHHHCCCSSCEEEEEECCTTCC
T ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCC
T ss_conf             99999998566430234530578999988700569999999769999999999999999983986589899937775454


Q ss_pred             -----EEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             -----996189999999999999999860
Q gi|254780477|r  207 -----NLYLGDMSEGVFSKIIDSMIQDST  230 (232)
Q Consensus       207 -----~~~~g~~~~~~~~~~id~ll~~~~  230 (232)
                           ..+.|+.++++|+++||++|.|+-
T Consensus       186 ~~~n~~~~~G~~~~e~~~~~Id~ll~ka~  214 (226)
T 3f4s_A          186 IEHNKVKHGGYKELKYFTNVIDKLYGKAI  214 (226)
T ss_dssp             CCGGGGEEESCCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf             56687672288899999999999999867
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, periplasm, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, thioredoxin-like, oxidoreductase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.76A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, PSI, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis V583} SCOP: c.47.1.13 Back     alignment and structure
>1bed_A DSBA oxidoreductase; TCPG, protein disulfide isomerase, disulfide oxidoreductase; 2.00A {Vibrio cholerae} SCOP: c.47.1.13 PDB: 2ijy_A Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio fischeri ES114} Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, plasmid, oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein DSBA; thioredoxin-fold, thiol-disulfide oxidoreductase, disulfide bond, periplasm; 1.58A {Salmonella enterica subsp} PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Back     alignment and structure
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural genomics, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, structural genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>3gl5_A Putative DSBA oxidoreductase SCO1869; probable DSBA oxidoreductase SCO1869, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.15A {Streptomyces coelicolor A3} Back     alignment and structure
>3kzq_A Putative uncharacterized protein VP2116; protein with unknown function, structural genomics, PSI, MCSG, protein structure initiative; HET: PG6; 2.10A {Vibrio parahaemolyticus} Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain ATCC 700825 / FA 1090), DSBC, structural genomics, unknown function; 2.00A {Neisseria gonorrhoeae fa 1090} Back     alignment and structure
>2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* Back     alignment and structure
>3fz5_A Possible 2-hydroxychromene-2-carboxylate isomerase; structural genomics, PSI-2, protein structure initiative; HET: MSE GTT PGE; 2.40A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1r4w_A Glutathione S-transferase, mitochondrial; glutathione transferase, kappa GST, RGSTK1-1; HET: GSH; 2.50A {Rattus norvegicus} SCOP: c.47.1.13 Back     alignment and structure
>1yzx_A Glutathione S-transferase kappa 1; glutathione sulfinate, peroxidase; HET: GSF; 1.93A {Homo sapiens} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB structural genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure