Q6ICB0 DESI1_HUMAN
Gene name: DESI1
Protein name: Desumoylating isopeptidase 1
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular protein modification process GO:0006464
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P17066 | HSPA6 | 0.93186 | immune system process GO:0002376 protein folding GO:0006457 response to stress GO:0006950 ... |
| 2 | Q96KF2 | PRAC1 | 0.7074 | |
| 3 | Q9NTK5 | OLA1 | 0.70693 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 4 | P57738 | TCTA | 0.69703 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 5 | O15552 | FFAR2 | 0.69547 | cell differentiation GO:0030154 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 6 | A0A1B0GUT2 | C10orf143 | 0.68719 | |
| 7 | Q5T319 | FAM182B | 0.67339 | |
| 8 | Q96BZ9 | TBC1D20 | 0.67123 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 9 | P53365 | ARFIP2 | 0.66989 | catabolic process GO:0009056 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 10 | Q8WWZ8 | OIT3 | 0.65894 | homeostatic process GO:0042592 |
20 40 60 80 100 AA: MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEA STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: ............................................................D......DDD.D............................ DO_SPOTD: DDDD................................................................................................ CONSENSUS: DDD................................................................................................. CONSENSUS_MOBI: DDDD................................................................................................
120 140 160 AA: YNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS STMI: DO_DISOPRED3: ....................................................DDDDDDDDDDDDDDDD DO_IUPRED2A: ......................................................DDDDDDDDDDDDDD DO_SPOTD: ....................................................DDDDDDDDDDDDDDDD CONSENSUS: ....................................................DDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................DDDDDDDDDDDDDDDDDDDD RICH_[G]: GGssvGrpnG RICH_MOBI_[G]: GGssvGrpnG RICH_MOBI_[GI]: IqIqppGGssvGrpnG