A0PJW8 DAPL1_HUMAN

Gene name: DAPL1
Protein name: Death-associated protein-like 1

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell death GO:0008219
- cell differentiation GO:0030154
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NRN5 OLFML3 0.92331 anatomical structure development GO:0048856
2 Q9ULV1 FZD4 0.9188 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
3 Q71UI9 H2AZ2 0.83874 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
4 Q14696 MESD 0.81893 anatomical structure development GO:0048856
cell junction organization GO:0034330
cell-cell signaling GO:0007267
...
5 Q96AE7 TTC17 0.81636 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
6 Q16881 TXNRD1 0.81346 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell population proliferation GO:0008283
...
7 Q99525 H4C7 0.78174 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
8 P62805 H4C1 0.71864 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 Q13576 IQGAP2 0.70772 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
immune system process GO:0002376
...
10 Q9P2S6 ANKMY1 0.70711

                                           20                  40                  60                  80                 100
AA:                      MANEVQDLLSPRKGGHPPAVKAGGMRISKKQEIGTLERHTKKTGFEKTSAIANVAKIQTLDALNDALEKLNYKFPATVHMAHQKPTPALEKVVPLKRIYI
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD............................DDDDDDDDDDD........................................................
DO_IUPRED2A:             .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................DD..D.DDDDD.............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................DDDDDDDDDDD.............
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
RICH_[K]:                            KgghppavKaggmrisKK                                                                      
RICH_[GK]:                           KGGhppavKaGGmrisKK                                                                      

                                      
AA:                      IQQPRKC
STMI:                           
DO_DISOPRED3:            .......
DO_IUPRED2A:             .......
DO_SPOTD:                DDDDDDD
CONSENSUS:               .......
CONSENSUS_MOBI:          .......