P62805 H4_HUMAN
Gene name: H4C1
Protein name: Histone H4
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q99525 | H4C7 | 0.99419 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 2 | Q9NRN5 | OLFML3 | 0.88656 | anatomical structure development GO:0048856 |
| 3 | A8MVJ9 | n/a | 0.81306 | cellular protein modification process GO:0006464 response to stress GO:0006950 |
| 4 | Q9ULV1 | FZD4 | 0.81063 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 5 | Q9NWY4 | HPF1 | 0.80509 | cellular protein modification process GO:0006464 response to stress GO:0006950 |
| 6 | P46781 | RPS9 | 0.76479 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | Q8N9B8 | RASGEF1A | 0.72474 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 8 | A0PJW8 | DAPL1 | 0.71864 | catabolic process GO:0009056 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | Q9Y272 | RASD1 | 0.70055 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 |
| 10 | Q6IBS0 | TWF2 | 0.69747 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
20 40 60 80 100 AA: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDD.DD..DDD............................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: D................................................................................................... RICH_[G]: GrGkGGkGlGkGG RICH_[K]: KggKglgKggaKrhrK RICH_[GK]: GrGKGGKGlGKGGaKrhrK RICH_fLPS_[G]: msGrGkGGkGlGkGGakrhr
AA: FGG STMI: DO_DISOPRED3: ... DO_IUPRED2A: ... DO_SPOTD: DDD CONSENSUS: ... CONSENSUS_MOBI: ...