Q99525 H4G_HUMAN
Gene name: H4C7
Protein name: Histone H4-like protein type G
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P62805 | H4C1 | 0.99419 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q9NRN5 | OLFML3 | 0.91478 | anatomical structure development GO:0048856 |
| 3 | Q9ULV1 | FZD4 | 0.86402 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 4 | A8MVJ9 | n/a | 0.81797 | cellular protein modification process GO:0006464 response to stress GO:0006950 |
| 5 | Q9NWY4 | HPF1 | 0.80601 | cellular protein modification process GO:0006464 response to stress GO:0006950 |
| 6 | A0PJW8 | DAPL1 | 0.78174 | catabolic process GO:0009056 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 7 | P46781 | RPS9 | 0.72964 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q9Y272 | RASD1 | 0.71007 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 |
| 9 | Q8N9B8 | RASGEF1A | 0.70503 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 10 | Q6IBS0 | TWF2 | 0.70294 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
20 40 60 80 AA: MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFKVFLENVIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD............................................................................ DO_IUPRED2A: .................................................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................D. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: .................................................................................................. RICH_[G]: GkaGkGlGkGG RICH_[K]: KagKglgKggaKchrK RICH_[GK]: GKaGKGlGKGGaKchrK RICH_fLPS_[G]: msvrGkaGkGlGkGG