A2RRL7 TM213_HUMAN
Gene name: TMEM213
Protein name: Transmembrane protein 213
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9P2H3 | IFT80 | 0.85749 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
2 | O15520 | FGF10 | 0.76194 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
3 | P31358 | CD52 | 0.75569 | homeostatic process GO:0042592 |
4 | Q9NRW7 | VPS45 | 0.70711 | protein transport GO:0015031 response to stress GO:0006950 transport GO:0006810 ... |
5 | Q86WI1 | PKHD1L1 | 0.70711 | immune system process GO:0002376 |
6 | Q8TBY0 | RBM46 | 0.61964 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
7 | Q9H596 | DUSP21 | 0.60971 | cellular protein modification process GO:0006464 |
8 | P51685 | CCR8 | 0.60914 | cell adhesion GO:0007155 homeostatic process GO:0042592 immune system process GO:0002376 ... |
9 | Q9ULB5 | CDH7 | 0.57253 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
10 | Q59H18 | TNNI3K | 0.5677 | cellular protein modification process GO:0006464 circulatory system process GO:0003013 |
20 40 60 80 100 AA: MQRLPAATRATLILSLAFASLHSACSAEASSSNSSSLTAHHPDPGTLEQCLNVDFCPQAARCCRTGVDEYGWIAAAVGWSLWFLTLILLCVDKLMKLTPD STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSS MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDD................DDDDDDDDDDD.............................................................. DO_IUPRED2A: ...................................DDDD............................................................. DO_SPOTD: DDD.......................DDDDDDDDDDDDDDDDDDDD....................................................DD CONSENSUS: DDDDDDDDDDDD............................... ......... CONSENSUS_MOBI: ........................................... ......... RICH_fLPS_[S]: eaSSSnSSSl
AA: EPKDLQA STMI: DO_DISOPRED3: ......D DO_IUPRED2A: ....DDD DO_SPOTD: DDDDDDD CONSENSUS: ....DDD CONSENSUS_MOBI: .......