A8MTZ0 BBIP1_HUMAN
Gene name: BBIP1
Protein name: BBSome-interacting protein 1
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | O94886 | TMEM63A | 0.82155 |
immune system process
GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
2 | P0DMB2 | C8orf88 | 0.81238 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
3 | Q96SR6 | ZNF382 | 0.81238 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
4 | Q9Y3C7 | MED31 | 0.80046 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
5 | Q8WYA0 | IFT81 | 0.76979 |
cellular component assembly
GO:0022607 cytoskeleton-dependent intracellular transport GO:0030705 protein transport GO:0015031 ... |
6 | Q96MR6 | CFAP57 | 0.76969 | |
7 | Q9NVH2 | INTS7 | 0.76125 |
biosynthetic process
GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
8 | O43827 | ANGPTL7 | 0.74637 |
anatomical structure development
GO:0048856 extracellular matrix organization GO:0030198 response to stress GO:0006950 |
9 | Q96EQ0 | SGTB | 0.74527 |
catabolic process
GO:0009056 protein folding GO:0006457 protein targeting GO:0006605 ... |
10 | Q3MHD2 | LSM12 | 0.73668 |
20 40 60 80
AA: MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDD....................................................................DDDDDDDD
DO_IUPRED2A: ..DDDDDDDDDDDDDDDDDDDDD....DDD......................................DDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD..........................................D..DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD......................................................................
RICH_[Q]: QaaQntirQQemaekdQrQ
RICH_[IQ]: IrQQemaekdQrQI
RICH_[MQ]: MhQaaQntirQQeM
RICH_fLPS_[Q]: hQaaQntirQQemaekdQrQ