A8MTZ0 BBIP1_HUMAN

Gene name: BBIP1
Protein name: BBSome-interacting protein 1

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein transport GO:0015031
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O94886 TMEM63A 0.82155 immune system process GO:0002376
transport GO:0006810
vesicle-mediated transport GO:0016192
2 P0DMB2 C8orf88 0.81238 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
3 Q96SR6 ZNF382 0.81238 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q9Y3C7 MED31 0.80046 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
5 Q8WYA0 IFT81 0.76979 cellular component assembly GO:0022607
cytoskeleton-dependent intracellular transport GO:0030705
protein transport GO:0015031
...
6 Q96MR6 CFAP57 0.76969
7 Q9NVH2 INTS7 0.76125 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
8 O43827 ANGPTL7 0.74637 anatomical structure development GO:0048856
extracellular matrix organization GO:0030198
response to stress GO:0006950
9 Q96EQ0 SGTB 0.74527 catabolic process GO:0009056
protein folding GO:0006457
protein targeting GO:0006605
...
10 Q3MHD2 LSM12 0.73668

                                           20                  40                  60                  80        
AA:                      MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH
STMI:                                                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDD....................................................................DDDDDDDD
DO_IUPRED2A:             ..DDDDDDDDDDDDDDDDDDDDD....DDD......................................DDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD..........................................D..DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDD......................................................................
RICH_[Q]:                                                                                      QaaQntirQQemaekdQrQ   
RICH_[IQ]:                                                                                           IrQQemaekdQrQI  
RICH_[MQ]:                                                                                   MhQaaQntirQQeM          
RICH_fLPS_[Q]:                                                                                hQaaQntirQQemaekdQrQ