Q9Y3C7 MED31_HUMAN

Gene name: MED31
Protein name: Mediator of RNA polymerase II transcription subunit 31

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P0DMB2 C8orf88 0.98676 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
2 Q96SR6 ZNF382 0.98676 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q9NVH2 INTS7 0.92755 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
4 Q3MHD2 LSM12 0.92218
5 O60437 PPL 0.88367 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
6 Q9Y6H3 ATP23 0.87115 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
7 O94886 TMEM63A 0.81639 immune system process GO:0002376
transport GO:0006810
vesicle-mediated transport GO:0016192
8 A8MTZ0 BBIP1 0.80046 cellular component assembly GO:0022607
protein transport GO:0015031
transport GO:0006810
9 P0C7V9 METTL15P1 0.79659 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
10 A8K554 ZNF815P 0.77765

                                           20                  40                  60                  80                 100
AA:                      MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDD.........................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDD......................................................................................
CONSENSUS:               DDDDDDDDDDD.........................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120         
AA:                      QILHWQHYSRKRMRLQQALAEQQQQNNTSGK
STMI:                                                   
DO_DISOPRED3:            ..............DDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .......................DDDDDDDD
DO_SPOTD:                ............DDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..............DDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...............................
RICH_[Q]:                               QQalaeQQQQ      
RICH_fLPS_[Q]:                         lQQalaeQQQQnnts