Q3MHD2 LSM12_HUMAN
Gene name: LSM12
Protein name: Protein LSM12 homolog
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9Y6H3 | ATP23 | 0.98925 |
cellular component assembly
GO:0022607 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
2 | Q9Y3C7 | MED31 | 0.92218 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
3 | Q96SR6 | ZNF382 | 0.90822 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
4 | Q96SA4 | SERINC2 | 0.85943 | |
5 | Q9NVH2 | INTS7 | 0.85391 |
biosynthetic process
GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
6 | O60437 | PPL | 0.81408 |
anatomical structure development
GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
7 | O94886 | TMEM63A | 0.75265 |
immune system process
GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
8 | A8MTZ0 | BBIP1 | 0.73668 |
cellular component assembly
GO:0022607 protein transport GO:0015031 transport GO:0006810 |
9 | P0C7V9 | METTL15P1 | 0.73319 |
cellular nitrogen compound metabolic process
GO:0034641 ribosome biogenesis GO:0042254 |
10 | A8K554 | ZNF815P | 0.71676 |
20 40 60 80 100
AA: MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSKLASKARTEKEEKLS
STMI:
DO_DISOPRED3: DDDDDD..............................................................................................
DO_IUPRED2A: ...............................................................................DDDDDDDD.............
DO_SPOTD: DDDD................................................................................................
CONSENSUS: DDDD................................................................................................
CONSENSUS_MOBI: ....................................................................................................
120 140 160 180
AA: QAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAALSS
STMI:
DO_DISOPRED3: ...........................................................................DDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A: ....................................................DD......................DDDDDD.DDD..DDDDDDD
DO_SPOTD: ..........................................................................DDDDDDDDDDDDDDDDDDDDD
CONSENSUS: ...........................................................................DDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI: ...............................................................................................
RICH_[AQ]: QAQQpQkeAA
RICH_[Q]: QkilQrsQaQQpQ
RICH_fLPS_[Q]: QkilQrsQaQQpQkeaalss