Q3MHD2 LSM12_HUMAN
Gene name: LSM12
Protein name: Protein LSM12 homolog
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y6H3 | ATP23 | 0.98925 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 2 | Q9Y3C7 | MED31 | 0.92218 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 3 | Q96SR6 | ZNF382 | 0.90822 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q96SA4 | SERINC2 | 0.85943 | |
| 5 | Q9NVH2 | INTS7 | 0.85391 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | O60437 | PPL | 0.81408 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 7 | O94886 | TMEM63A | 0.75265 | immune system process GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 8 | A8MTZ0 | BBIP1 | 0.73668 | cellular component assembly GO:0022607 protein transport GO:0015031 transport GO:0006810 |
| 9 | P0C7V9 | METTL15P1 | 0.73319 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 10 | A8K554 | ZNF815P | 0.71676 |
20 40 60 80 100 AA: MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSKLASKARTEKEEKLS STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: ...............................................................................DDDDDDDD............. DO_SPOTD: DDDD................................................................................................ CONSENSUS: DDDD................................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: QAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAALSS STMI: DO_DISOPRED3: ...........................................................................DDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ....................................................DD......................DDDDDD.DDD..DDDDDDD DO_SPOTD: ..........................................................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...........................................................................DDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ............................................................................................... RICH_[AQ]: QAQQpQkeAA RICH_[Q]: QkilQrsQaQQpQ RICH_fLPS_[Q]: QkilQrsQaQQpQkeaalss