C9JUS6 ADM5_HUMAN

Gene name: ADM5
Protein name: Putative adrenomedullin-5-like protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NPH2 ISYNA1 0.88492 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
2 Q9Y6K5 OAS3 0.88492 biological process involved in symbiotic interaction GO:0044403
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
3 P15941 MUC1 0.83617 biosynthetic process GO:0009058
cell adhesion GO:0007155
cell cycle GO:0007049
...
4 Q9NQ31 AKIP1 0.79149 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
5 P56746 CLDN15 0.78308 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
...
6 Q96GV9 MACIR 0.77356 cellular component assembly GO:0022607
protein transport GO:0015031
response to stress GO:0006950
...
7 A6NH21 SERINC4 0.72009 biosynthetic process GO:0009058
8 O43555 GNRH2 0.71985 anatomical structure development GO:0048856
reproduction GO:0000003
signal transduction GO:0007165
9 Q93038 TNFRSF25 0.71483 cell death GO:0008219
signal transduction GO:0007165
10 O14531 DPYSL4 0.70746 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MTIHILILLLLLAFSAQGDLDTAARRGQHQVPQHRGHVCYLGVCRTHRLAEIIYWIRCLHQGALGEGQPRAPGPLQLWAPPVARGGSPARFPGFRPAARG
STMI:                    SSSSSSSSSSSSSSSSSS                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD.DDD............................................DDDDDDDDDDDDDDDDDDDDDDDD....
DO_IUPRED2A:             .......................DDDDD..........................................D...DD.D......................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                 DDDDDDDDDD..........................................DDDDDDDDDDDDDDDDDDDDDDDDDD....
CONSENSUS_MOBI:                            ..................................................................................
RICH_[AP]:                                                                                     APgPlqlwAPPvArggsPA           
RICH_[FG]:                                                                                                   GGsparFpGF      

                                          120                 140       
AA:                      LAQCPARWVTSGTARPLLGFSLPICMLELLLHISSPLTPAPETVFPSPSPGCD
STMI:                                                                         
DO_DISOPRED3:            ........................................DDDDDDDDDDDDD
DO_IUPRED2A:             ...........................................DDDDDDDDD.
DO_SPOTD:                DD.............DD..D.DD..........DDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ........................................DDDDDDDDDDDDD
CONSENSUS_MOBI:          .....................................................