Q96GV9 MACIR_HUMAN

Gene name: MACIR
Protein name: Macrophage immunometabolism regulator

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein transport GO:0015031
- response to stress GO:0006950
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P48145 NPBWR1 0.87416 cell-cell signaling GO:0007267
signal transduction GO:0007165
2 Q9NPH2 ISYNA1 0.87416 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
3 Q9Y6K5 OAS3 0.87416 biological process involved in symbiotic interaction GO:0044403
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
4 P15941 MUC1 0.82601 biosynthetic process GO:0009058
cell adhesion GO:0007155
cell cycle GO:0007049
...
5 Q9NQ31 AKIP1 0.78187 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
6 P56746 CLDN15 0.77356 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
...
7 C9JUS6 ADM5 0.77356
8 A6NH21 SERINC4 0.71133 biosynthetic process GO:0009058
9 O43555 GNRH2 0.7111 anatomical structure development GO:0048856
reproduction GO:0000003
signal transduction GO:0007165
10 Q93038 TNFRSF25 0.70614 cell death GO:0008219
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKCTGGEESKAEAMPSLRSKQLDAGL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDD.........
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDD.........................DDD....DDDDDDDDDDDDDDD....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D........................................DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................DDDDDDDDDDDDDDD....
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................................
RICH_[AP]:                               PfPgAeAnsPgkAeAekP                                                                  

                                          120                 140                 160                 180                 200
AA:                      ARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKSLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEPADTEVLQYQLQHLTLRGDRV
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             .D...............DDDDDDDDDDDDDDDDDDDDD..............................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDD.D........................................................
CONSENSUS:               .D...............DDDDDDDDDDDDDDDDDDDDD..............................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_fLPS_[R]:                              pavngRRRRR                                                                       

                                       
AA:                      FARNNT
STMI:                          
DO_DISOPRED3:            ...DDD
DO_IUPRED2A:             .....D
DO_SPOTD:                ...DDD
CONSENSUS:               ...DDD
CONSENSUS_MOBI:          ......