Q9NQ31 AKIP1_HUMAN
Gene name: AKIP1
Protein name: A-kinase-interacting protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IZ96 | CMTM1 | 0.89443 | |
| 2 | Q9Y6K5 | OAS3 | 0.89443 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 3 | A6NNN8 | SLC38A8 | 0.89443 | transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | P15941 | MUC1 | 0.84516 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cell cycle GO:0007049 ... |
| 5 | P56746 | CLDN15 | 0.79149 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 6 | Q96GV9 | MACIR | 0.78187 | cellular component assembly GO:0022607 protein transport GO:0015031 response to stress GO:0006950 ... |
| 7 | A6NH21 | SERINC4 | 0.72783 | biosynthetic process GO:0009058 |
| 8 | O43555 | GNRH2 | 0.72759 | anatomical structure development GO:0048856 reproduction GO:0000003 signal transduction GO:0007165 |
| 9 | Q93038 | TNFRSF25 | 0.72251 | cell death GO:0008219 signal transduction GO:0007165 |
| 10 | O14531 | DPYSL4 | 0.71506 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGEREERPPTLSASFRTMAEFMDYTSSQC STMI: DO_DISOPRED3: DD.......DD........................................DDDDDDDD......DDDD............................... DO_IUPRED2A: ...................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................ DO_SPOTD: DD......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................... CONSENSUS: DD.................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD...................... CONSENSUS_MOBI: .........................................................DDDDDDDDDDDDDDDDDDDDDDD.................... RICH_[AP]: AreAPhlekqPAAgPqrvlP RICH_[ER]: RvlpgEREER
120 140 160 180 200 AA: GKYYSSVPEEGGATHVYRYHRGESKLHMCLDIGNGQRKDRKKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDS STMI: DO_DISOPRED3: ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................... DO_IUPRED2A: .....D.......DDDDD...........DDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D........................D.D..... DO_SPOTD: ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................. CONSENSUS: .............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................... CONSENSUS_MOBI: ...................................DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
AA: GQSVDLVFPV STMI: DO_DISOPRED3: .......... DO_IUPRED2A: .......... DO_SPOTD: .......... CONSENSUS: .......... CONSENSUS_MOBI: ..........