O43555 GON2_HUMAN

Gene name: GNRH2
Protein name: Progonadoliberin-2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- reproduction GO:0000003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IZ96 CMTM1 0.81347
2 Q9Y6K5 OAS3 0.81347 biological process involved in symbiotic interaction GO:0044403
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
3 P15941 MUC1 0.76866 biosynthetic process GO:0009058
cell adhesion GO:0007155
cell cycle GO:0007049
...
4 Q9NQ31 AKIP1 0.72759 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
5 P56746 CLDN15 0.71985 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
...
6 Q96GV9 MACIR 0.7111 cellular component assembly GO:0022607
protein transport GO:0015031
response to stress GO:0006950
...
7 A6NH21 SERINC4 0.66195 biosynthetic process GO:0009058
8 Q93038 TNFRSF25 0.65711 cell death GO:0008219
signal transduction GO:0007165
9 O14531 DPYSL4 0.65034 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
10 Q69YG0 TMEM42 0.63521

                                           20                  40                  60                  80                 100
AA:                      MASSRRGLLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTTAQWSLHRKRHLA
STMI:                    SSSSSSSSSSSSSSSSSSSSSSS                                                                             
DO_DISOPRED3:            DDDDDDDDDDDDDDD.............................DDDDDDDD................................................
DO_IUPRED2A:             ........................DDD.DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDD........
DO_SPOTD:                DDDD...............DDDDDD..DD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.............................
CONSENSUS:                                      .DDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
CONSENSUS_MOBI:                                 DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
RICH_[AP]:                                                          PqnAlrPPgrAldtAAgsP                                      
RICH_MOBI_[DL]:                                                                              LpsDaLapLDD                     
RICH_MOBI_[GH]:                                  HwsHGwypGG