E5RG02 PRS46_HUMAN
Gene name: PRSS46P
Protein name: Putative serine protease 46
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P13584 | CYP4B1 | 0.76822 | catabolic process GO:0009056 |
| 2 | Q16706 | MAN2A1 | 0.69048 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | Q9Y294 | ASF1A | 0.6627 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 4 | Q14849 | STARD3 | 0.64478 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 transport GO:0006810 ... |
| 5 | Q9H159 | CDH19 | 0.61782 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 6 | Q9ULS6 | KCNS2 | 0.53399 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
| 7 | Q6P9F7 | LRRC8B | 0.52686 | response to stress GO:0006950 transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | Q96AQ7 | CIDEC | 0.48766 | cell death GO:0008219 |
| 9 | Q9UFV1 | TBC1D29P | 0.48469 | protein transport GO:0015031 transport GO:0006810 |
| 10 | Q96SZ6 | CDK5RAP1 | 0.47538 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSGSLIHHQWVLTAAHCLQRFKDLSLYSVMVGV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[LS]: LqSLtSpLSS
120 140 160 AA: HQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISWSPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG STMI: DO_DISOPRED3: .......................................................................DDD DO_IUPRED2A: .......................................................................... DO_SPOTD: ......................................................................DDDD CONSENSUS: .......................................................................DDD CONSENSUS_MOBI: ..........................................................................