Q9UFV1 TBC29_HUMAN

Gene name: TBC1D29P
Protein name: Putative TBC1 domain family member 29

List of terms from Generic GO subset, which this protein is a part of:
- protein transport GO:0015031
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q16706 MAN2A1 0.66682 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
2 Q9H159 CDH19 0.66051 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
3 Q9Y294 ASF1A 0.6255 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q6P9F7 LRRC8B 0.60616 response to stress GO:0006950
transmembrane transport GO:0055085
transport GO:0006810
5 Q16890 TPD52L1 0.5981 cell cycle GO:0007049
cell death GO:0008219
cellular protein modification process GO:0006464
...
6 P51582 P2RY4 0.55561 cell-cell signaling GO:0007267
homeostatic process GO:0042592
signal transduction GO:0007165
...
7 Q9ULS6 KCNS2 0.54274 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
transmembrane transport GO:0055085
...
8 A0A1B0GUV7 TEX48 0.54217
9 Q14849 STARD3 0.54026 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
transport GO:0006810
...
10 Q9H5Q4 TFB2M 0.52853

                                           20                  40                  60                  80                 100
AA:                      MGHLDKEGLCTQGSSFSWLLRVLNDGISLGLTPCLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETWGPATPRALKGTGRARPICESLHSSLQALTA
STMI:                                                                                                                        
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             .................................................................DDD..DDDDDDD.......................
DO_SPOTD:                DDDDD...............................................................................................
CONSENSUS:               DD..................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140          
AA:                      SESSRGPSLLQTPPRVPGQQALSRGDKGISVSLSLPSLPSRRGRCGRIIG
STMI:                                                                      
DO_DISOPRED3:            ........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...DDDDDDDDDDDDDDDDDDDD.........DD................
DO_SPOTD:                .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .DDDDDDDDDDDDDDDDDDDDDDDD.........................
RICH_[S]:                                      SrgdkgiSvSlSlpSlpS          
RICH_[GR]:                                                       RRGRcGRiiG
RICH_[LS]:                                    LSrgdkgiSvSLSLpSLpS          
RICH_MOBI_[LQ]:                  LLQtpprvpgQQaL