H3BNL1 CC084_HUMAN
Gene name: C3orf84
Protein name: Uncharacterized protein C3orf84
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H3Y6 | SRMS | 0.87416 | cell differentiation GO:0030154 cell population proliferation GO:0008283 cellular protein modification process GO:0006464 ... |
| 2 | Q9NY64 | SLC2A8 | 0.87416 | carbohydrate metabolic process GO:0005975 cell cycle GO:0007049 membrane organization GO:0061024 ... |
| 3 | Q96LW7 | CARD19 | 0.87416 | signal transduction GO:0007165 |
| 4 | Q9BZR9 | TRIM8 | 0.8218 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q8N5N4 | C3orf22 | 0.77356 | |
| 6 | O75147 | OBSL1 | 0.76595 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 7 | Q9BQI0 | AIF1L | 0.75898 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 8 | Q9UJ71 | CD207 | 0.73277 | immune system process GO:0002376 response to stress GO:0006950 transport GO:0006810 ... |
| 9 | O95140 | MFN2 | 0.72734 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 10 | O14520 | AQP7 | 0.71614 | transport GO:0006810 |
20 40 60 80 100 AA: MQSALVGSWHNNGFYGHYRSQFKSESAREYHLAAKPQPPAVFLQRCQEPAQRHFFSKHDNRTSFDKGPYCLLQGIGRRKDLERLWQRHTFLRWAPCEIEL STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: ............................DD............D.............DD.......................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDD.........DDDDDDD..DD........DDD CONSENSUS: DD..........................D...........................DD.......................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: RQQGPLESSYQADFRPGPGLSGLPQHLIHFVQVQPSHTRTTYQQNFCCPSQGGHYGSYKVGPQAPVTDVLPDLPGIPRPKLLQHYLHAGVSECLNWSRAL STMI: DO_DISOPRED3: ........................................................DDDDDDDDDDDDDDDDDDDDDDD.D................... DO_IUPRED2A: ........D.DD..D............................D..............D.........DDD............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................D CONSENSUS: ........DDDDDDD............................D............DDDDDDDDDDDDDDDDDDDDDDDDD................... CONSENSUS_MOBI: .................................................................................................... RICH_[P]: PqaPvtdvlPdlPgiPrP RICH_[V]: VgpqapVtdV
AA: NKDS STMI: DO_DISOPRED3: ..DD DO_IUPRED2A: .... DO_SPOTD: DDDD CONSENSUS: ..DD CONSENSUS_MOBI: ....