Q96LW7 CAR19_HUMAN
Gene name: CARD19
Protein name: Caspase recruitment domain-containing protein 19
List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BZR9 | TRIM8 | 0.9401 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q8N5N4 | C3orf22 | 0.88492 | |
| 3 | O75147 | OBSL1 | 0.87622 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 4 | H3BNL1 | C3orf84 | 0.87416 | |
| 5 | Q9BQI0 | AIF1L | 0.86824 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 6 | Q9UJ71 | CD207 | 0.83826 | immune system process GO:0002376 response to stress GO:0006950 transport GO:0006810 ... |
| 7 | O95140 | MFN2 | 0.83205 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 8 | O14520 | AQP7 | 0.81923 | transport GO:0006810 |
| 9 | Q9P283 | SEMA5B | 0.79543 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 10 | P27986 | PIK3R1 | 0.79262 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHA STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: ...................................................................................................D
120 140 160 180 200 AA: LRKFHITNHACLVLARGGHPSLPLMAWMSSMTTQVCCSPGLASPLASAPPQRPPSGPEGRVWQAQAVQMLVSVSHFLPLPPSLSHGSFHTAWGILYVHSC STMI: DO_DISOPRED3: ..........................................DDDDDDDDDDDDD............................................. DO_IUPRED2A: ..............................................DDDDDDDDDDDDDD........................................ DO_SPOTD: .........................................DDDDDDDDDDDDDDDD........................................... CONSENSUS: ..........................................DDDDDDDDDDDDDDD........................................... CONSENSUS_MOBI: D................................................................................................... RICH_[P]: PlasaPPqrPPsgP
220 AA: PSFSNLIPRGSLHVCVDSNLVPTAAWRS STMI: DO_DISOPRED3: ...........................D DO_IUPRED2A: ............................ DO_SPOTD: ............................ CONSENSUS: ............................ CONSENSUS_MOBI: ............................