Q9BQI0 AIF1L_HUMAN
Gene name: AIF1L
Protein name: Allograft inflammatory factor 1-like
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q14626 | IL11RA | 0.98526 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165 |
| 2 | P60606 | CTXN1 | 0.96476 | |
| 3 | Q96QK8 | SMIM14 | 0.96476 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 4 | Q16613 | AANAT | 0.95512 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 5 | A0PG75 | PLSCR5 | 0.94818 | membrane organization GO:0061024 plasma membrane organization GO:0007009 transport GO:0006810 |
| 6 | P50281 | MMP14 | 0.91446 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 7 | O75880 | SCO1 | 0.90911 | catabolic process GO:0009056 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 8 | Q8IY18 | SMC5 | 0.90576 | cell cycle GO:0007049 cell division GO:0051301 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q9Y4U1 | MMACHC | 0.89296 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 10 | O75871 | CEACAM4 | 0.87149 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
20 40 60 80 100 AA: MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVS STMI: DO_DISOPRED3: DDDDDDDD............................................................................................ DO_IUPRED2A: ...........................................................................................D........ DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDD............................................................................................ CONSENSUS_MOBI: DDDDDDDDDDDD........................................................................................
120 140 AA: DTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP STMI: DO_DISOPRED3: .................................................. DO_IUPRED2A: ..............................DDDDDDDDDDDDDDDDDDDD DO_SPOTD: ............................DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..............................DDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...........................DDDDDDDDDDDDDDDDDDDDDDD RICH_[P]: PkPvgPPPerdiaslP RICH_MOBI_[P]: PkPvgPPPerdiaslP