O00212 RHOD_HUMAN
Gene name: RHOD
Protein name: Rho-related GTP-binding protein RhoD
List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- cell junction organization GO:0034330
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- protein targeting GO:0006605
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H7H0 | METTL17 | 0.69774 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 2 | Q9UL63 | MKLN1 | 0.69774 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell morphogenesis GO:0000902 ... |
| 3 | O43612 | HCRT | 0.69774 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 4 | A6NMB1 | SIGLEC16 | 0.58502 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 |
| 5 | Q6DD88 | ATL3 | 0.56266 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 6 | Q8N4F7 | RNF175 | 0.55819 | catabolic process GO:0009056 response to stress GO:0006950 signal transduction GO:0007165 |
| 7 | Q7RTP0 | NIPA1 | 0.53164 | transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | Q96S52 | PIGS | 0.52728 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 9 | Q9HCM9 | TRIM39 | 0.51863 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 10 | Q9UFG5 | C19orf25 | 0.51009 |
20 40 60 80 100 AA: MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD.........................................................DDDDDDDDDDD............... DO_IUPRED2A: .DDDDDD............................................................................................. DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDDDDDDDD...................................................................................... CONSENSUS_MOBI: ......DDDDDDDD.........................DDDDDDD..........................DDDDDDDDDDDDDDD............. RICH_fLPS_[A]: tAAqAAgeeA RICH_MOBI_[DY]: DDYDrlrplfY
120 140 160 180 200 AA: PNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLCKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWR STMI: DO_DISOPRED3: ..............................................................................................DDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: .............................................................................................DDDD...
AA: RITQGFCVVT STMI: DO_DISOPRED3: DDDDD....D DO_IUPRED2A: .......... DO_SPOTD: .......... CONSENSUS: .......... CONSENSUS_MOBI: ..........