O43612 OREX_HUMAN

Gene name: HCRT
Protein name: Orexin

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell-cell signaling GO:0007267
- homeostatic process GO:0042592
- nervous system process GO:0050877
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A6NMB1 SIGLEC16 0.83844 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950
2 Q6DD88 ATL3 0.8064 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
3 Q8N4F7 RNF175 0.8 catabolic process GO:0009056
response to stress GO:0006950
signal transduction GO:0007165
4 Q7RTP0 NIPA1 0.76194 transmembrane transport GO:0055085
transport GO:0006810
5 Q96S52 PIGS 0.75569 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
6 Q9HCM9 TRIM39 0.74329 catabolic process GO:0009056
cell cycle GO:0007049
cell death GO:0008219
...
7 Q96B86 RGMA 0.74329 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q96FN4 CPNE2 0.73106
9 Q9UFG5 C19orf25 0.73106
10 Q9GZT3 SLIRP 0.72761 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRR
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDD...DD................................................................................
DO_IUPRED2A:             ...............................................................DD.........D.DDDDD.............D.DDD.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDDD.......DDDDDDDDD.DDDD
CONSENSUS:                                                .........................................DDDDD...............D.DDD.
CONSENSUS_MOBI:                                           ...................................................................

                                          120         
AA:                      AGAEPAPRPCLGRRCSAPAAASVAPGGQSGI
STMI:                                                   
DO_DISOPRED3:            ...........D..DDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .........................D.D...
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...........D..DDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...............................
RICH_fLPS_[A]:                         csApAAAsvA