O00233 PSMD9_HUMAN
Gene name: PSMD9
Protein name: 26S proteasome non-ATPase regulatory subunit 9
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BWS9 | CHID1 | 0.83603 | carbohydrate metabolic process GO:0005975 immune system process GO:0002376 response to stress GO:0006950 ... |
| 2 | Q12798 | CETN1 | 0.78371 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 3 | O94903 | PLPBP | 0.78236 | |
| 4 | P58550 | FXYD6P3 | 0.74072 | transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | O95843 | GUCA1C | 0.73828 | nervous system process GO:0050877 signal transduction GO:0007165 |
| 6 | P16402 | H1-3 | 0.72526 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q969F0 | FATE1 | 0.72228 | cell death GO:0008219 homeostatic process GO:0042592 |
| 8 | Q6NXT2 | H3-5 | 0.71493 | growth GO:0040007 |
| 9 | P07305 | H1-0 | 0.6929 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 10 | Q9BY44 | EIF2A | 0.68986 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDD......DD.D.....DD....DD..D.....DDDDD.........D.......................DDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: HARDKEKQARDMAEAHKEAMSRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKPLNVTVIRRGEKHQ STMI: DO_DISOPRED3: ...............D.DDDDDDDDDDDDD...................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....D...........................DD.D.D.....DDDDDDD....... DO_SPOTD: ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS_MOBI: ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................... RICH_[AK]: KeKqArdmAeAhKeAmsrK RICH_[K]: KeKqardmaeahKeamsrK RICH_MOBI_[AK]: KeKqArdmAeAhKeAmsrK RICH_MOBI_[AM]: ArdMAeAhkeAM RICH_MOBI_[K]: KeKqardmaeahKeamsrK RICH_MOBI_[KM]: KeKqardMaeahKeaMsrK
220 AA: LRLVPTRWAGKGLLGCNIIPLQR STMI: DO_DISOPRED3: ....................... DO_IUPRED2A: ....................... DO_SPOTD: ....................... CONSENSUS: ....................... CONSENSUS_MOBI: .......................