P58550 FXYD8_HUMAN

Gene name: FXYD6P3
Protein name: Putative FXYD domain-containing ion transport regulator 8

List of terms from Generic GO subset, which this protein is a part of:
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BWS9 CHID1 0.87219 carbohydrate metabolic process GO:0005975
immune system process GO:0002376
response to stress GO:0006950
...
2 O94903 PLPBP 0.84026
3 Q12798 CETN1 0.8104 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
...
4 P16402 H1-3 0.765 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
5 Q99741 CDC6 0.76016 biosynthetic process GO:0009058
cell cycle GO:0007049
cell division GO:0051301
...
6 Q6NXT2 H3-5 0.74566 growth GO:0040007
7 O00233 PSMD9 0.74072 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 P07305 H1-0 0.73331 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
9 Q9BY44 EIF2A 0.73223 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 Q5VTE0 EEF1A1P5 0.72661 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412

                                           20                  40                  60                  80      
AA:                      MEVVLIFVYSLLVPVVLASAAKEKEIDPFHYNYQTLRIGGLVFDVVLFLVPSCHLLSHRCKCSFNQKPQDPGDKEAQVENFITANAKEPQKAKN
STMI:                    SSSSSSSSSSSSSSSSSS                MMMMMMMMMMMMMMMMMMMMMMMM                                    
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD...D...................................................DDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..........................................................................D................DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDDD..DDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                 ...D............                        ...............DDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                            ................                        .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AK]:                                                                                        KeAqvenfitAnAKepqKAK 
RICH_[K]:                                                                                         KeaqvenfitanaKepqKaK 
RICH_[KN]:                                                                                                   NaKepqKaKN
RICH_MOBI_[AK]:                                                                                   KeAqvenfitAnAKepqKAK 
RICH_MOBI_[K]:                                                                                    KeaqvenfitanaKepqKaK 
RICH_MOBI_[N]:                                                                                          NfitaNakepqkakN
RICH_MOBI_[KN]:                                                                                              NaKepqKaKN