O00762 UBE2C_HUMAN
Gene name: UBE2C
Protein name: Ubiquitin-conjugating enzyme E2 C
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- homeostatic process GO:0042592
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q13619 | CUL4A | 0.9314 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
2 | P50440 | GATM | 0.90921 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 homeostatic process GO:0042592 ... |
3 | P28072 | PSMB6 | 0.90882 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
4 | Q8N4E7 | FTMT | 0.90823 | cell population proliferation GO:0008283 homeostatic process GO:0042592 transport GO:0006810 |
5 | P0DMW3 | SMIM10L1 | 0.90641 | |
6 | Q9Y3B1 | PRELID3B | 0.898 | transport GO:0006810 |
7 | P51817 | PRKX | 0.86519 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
8 | Q5VW00 | DCAF12L2 | 0.86004 | |
9 | Q9H1K6 | TLNRD1 | 0.85994 | |
10 | Q9NYX4 | CALY | 0.85945 | cellular component assembly GO:0022607 protein transport GO:0015031 protein-containing complex assembly GO:0065003 ... |
20 40 60 80 100 AA: MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLT STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ RICH_[AG]: AtsvAAArkGAepsGGAArG RICH_[A]: AsqnrdpAAtsvAAArkgAepsggAA RICH_fLPS_[A]: pAAtsvAAArkgAepsggAA RICH_MOBI_[A]: AsqnrdpAAtsvAAArkgAepsggAA RICH_fLPS_MOBI_[A]: pAAtsvAAArkgAepsggAA
120 140 160 AA: PCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP STMI: DO_DISOPRED3: .............................................................................DD DO_IUPRED2A: ...........................................................................DDDD DO_SPOTD: ..........................................................................DDDDD CONSENSUS: ...........................................................................DDDD CONSENSUS_MOBI: ...........................................................................DDDD