P28072 PSB6_HUMAN
Gene name: PSMB6
Protein name: Proteasome subunit beta type-6
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P50440 | GATM | 0.99999 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 homeostatic process GO:0042592 ... |
| 2 | Q9Y3B1 | PRELID3B | 0.99658 | transport GO:0006810 |
| 3 | P0DMW3 | SMIM10L1 | 0.98918 | |
| 4 | Q8N4E7 | FTMT | 0.98 | cell population proliferation GO:0008283 homeostatic process GO:0042592 transport GO:0006810 |
| 5 | P51817 | PRKX | 0.9342 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 6 | O00762 | UBE2C | 0.90882 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 7 | Q5VU92 | DCAF12L1 | 0.89282 | |
| 8 | Q96I15 | SCLY | 0.88307 | small molecule metabolic process GO:0044281 |
| 9 | Q96BN8 | OTULIN | 0.87954 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | O43930 | PRKY | 0.87427 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
20 40 60 80 100 AA: MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFH STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: ................DDDDDDDDDD.D........................................................................ DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... RICH_[A]: AAtllAArgAgpApAwgpeA RICH_fLPS_[A]: AAtllAArgAgpApAwgpeA RICH_MOBI_[A]: AAtllAArgAgpApAwgpeA RICH_fLPS_MOBI_[A]: AAtllAArgAgpApAwgpeA
120 140 160 180 200 AA: SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMER STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: DGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA STMI: DO_DISOPRED3: ......................................D DO_IUPRED2A: ....................................... DO_SPOTD: ......................................D CONSENSUS: ......................................D CONSENSUS_MOBI: .......................................