P0DMW3 SIML1_HUMAN

Gene name: SMIM10L1
Protein name: Small integral membrane protein 10-like protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N4E7 FTMT 0.99756 cell population proliferation GO:0008283
homeostatic process GO:0042592
transport GO:0006810
2 Q9Y3B1 PRELID3B 0.99306 transport GO:0006810
3 P50440 GATM 0.98966 anatomical structure development GO:0048856
biosynthetic process GO:0009058
homeostatic process GO:0042592
...
4 P28072 PSMB6 0.98918 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
5 P51817 PRKX 0.94354 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
6 Q5VU92 DCAF12L1 0.90728
7 O00762 UBE2C 0.90641 catabolic process GO:0009056
cell cycle GO:0007049
cell division GO:0051301
...
8 Q96I15 SCLY 0.89763 small molecule metabolic process GO:0044281
9 O43678 NDUFA2 0.89278 anatomical structure development GO:0048856
cellular component assembly GO:0022607
embryo development GO:0009790
...
10 Q96BN8 OTULIN 0.88479 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60            
AA:                      MAPAAAPSSLAVRASSPAATPTSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVILNIRLQVHI
STMI:                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD.D...................................................
DO_IUPRED2A:             ....................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD...............................................
CONSENSUS:               DDDDDDDDDDDDDDDDD...................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD...............................................
RICH_[A]:                 ApAAApsslAvrA                                                      
RICH_fLPS_[A]:           mApAAApsslAvrAs                                                     
RICH_MOBI_[A]:            ApAAApsslAvrAsspAA                                                 
RICH_fLPS_MOBI_[A]:      mApAAApsslAvrAsspAAt