P0DMW3 SIML1_HUMAN
Gene name: SMIM10L1
Protein name: Small integral membrane protein 10-like protein 1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N4E7 | FTMT | 0.99756 | cell population proliferation GO:0008283 homeostatic process GO:0042592 transport GO:0006810 |
| 2 | Q9Y3B1 | PRELID3B | 0.99306 | transport GO:0006810 |
| 3 | P50440 | GATM | 0.98966 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 homeostatic process GO:0042592 ... |
| 4 | P28072 | PSMB6 | 0.98918 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 5 | P51817 | PRKX | 0.94354 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 6 | Q5VU92 | DCAF12L1 | 0.90728 | |
| 7 | O00762 | UBE2C | 0.90641 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 8 | Q96I15 | SCLY | 0.89763 | small molecule metabolic process GO:0044281 |
| 9 | O43678 | NDUFA2 | 0.89278 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 embryo development GO:0009790 ... |
| 10 | Q96BN8 | OTULIN | 0.88479 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 AA: MAPAAAPSSLAVRASSPAATPTSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVILNIRLQVHI STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD.D................................................... DO_IUPRED2A: .................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................... CONSENSUS: DDDDDDDDDDDDDDDDD................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............................................... RICH_[A]: ApAAApsslAvrA RICH_fLPS_[A]: mApAAApsslAvrAs RICH_MOBI_[A]: ApAAApsslAvrAsspAA RICH_fLPS_MOBI_[A]: mApAAApsslAvrAsspAAt