Q9Y3B1 PLD3B_HUMAN
Gene name: PRELID3B
Protein name: PRELI domain containing protein 3B
List of terms from Generic GO subset, which this protein is a part of:
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P50440 | GATM | 0.99664 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 homeostatic process GO:0042592 ... |
| 2 | P28072 | PSMB6 | 0.99658 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 3 | P0DMW3 | SMIM10L1 | 0.99306 | |
| 4 | Q8N4E7 | FTMT | 0.98273 | cell population proliferation GO:0008283 homeostatic process GO:0042592 transport GO:0006810 |
| 5 | P51817 | PRKX | 0.9335 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 6 | O00762 | UBE2C | 0.898 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 7 | Q96I15 | SCLY | 0.89453 | small molecule metabolic process GO:0044281 |
| 8 | Q5VU92 | DCAF12L1 | 0.89453 | |
| 9 | Q96BN8 | OTULIN | 0.87843 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | O43678 | NDUFA2 | 0.87056 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 embryo development GO:0009790 ... |
20 40 60 80 100 AA: MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVVDPVEKTMELKSTNISF STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ....................DDD.D..........DD..........................................D.D......D........... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: TNMVSVDERLIYKPHPQDPEKTVLTQEAIITVKGVSLSSYLEGLMASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK STMI: DO_DISOPRED3: ..........................................................................DDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..........DD..DDDD....DD..................................................D................... DO_SPOTD: ............................................................................DDDDDDDDDDDDDDDDDD CONSENSUS: ..........................................................................DDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .......................................................................DDDDDDDDDDDDDDDDDDDDDDD RICH_[A]: AsArgtirtpmAAAAfA RICH_fLPS_[A]: tAsArgtirtpmAAAAfAek RICH_MOBI_[A]: AsArgtirtpmAAAAfA RICH_fLPS_MOBI_[A]: eltAsArgtirtpmAAAAfA