Q969L2 MAL2_HUMAN
Gene name: MAL2
Protein name: Protein MAL2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5JST6 | EFHC2 | 0.9848 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 2 | Q96HD1 | CRELD1 | 0.97823 | anatomical structure development GO:0048856 |
| 3 | Q9NYA1 | SPHK1 | 0.97823 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | O14543 | SOCS3 | 0.96226 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 5 | P17405 | SMPD1 | 0.95762 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 6 | P27986 | PIK3R1 | 0.94318 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 7 | Q0P6H9 | TMEM62 | 0.88942 | |
| 8 | Q9NVV9 | THAP1 | 0.86181 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell population proliferation GO:0008283 ... |
| 9 | Q8IVL5 | P3H2 | 0.83844 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 |
| 10 | Q9BSK0 | MARVELD1 | 0.83844 | anatomical structure development GO:0048856 cell cycle GO:0007049 |
20 40 60 80 100 AA: MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNF STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. DO_IUPRED2A: ..DD................................................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD............ ........... ............. CONSENSUS_MOBI: .................................. ........... ............. RICH_[P]: PPPPnPavsfPPP RICH_fLPS_[P]: saggasvPPPPnPavsfPPP
120 140 160 AA: LDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ............................................................................ DO_IUPRED2A: ............................................................................ DO_SPOTD: ............................................................................ CONSENSUS: .. .......................... ...... CONSENSUS_MOBI: .. .......................... ......