O14950 ML12B_HUMAN
Gene name: MYL12B
Protein name: Myosin regulatory light chain 12B
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell morphogenesis GO:0000902
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NZH5 | PTTG2 | 0.87171 | cell cycle GO:0007049 chromosome organization GO:0051276 chromosome segregation GO:0007059 ... |
| 2 | O43405 | COCH | 0.83535 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 3 | Q8N7R0 | NANOGP1 | 0.83392 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q96RR1 | TWNK | 0.81076 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q8IYB8 | SUPV3L1 | 0.79718 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 6 | O60669 | SLC16A7 | 0.777 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | Q9UKF2 | ADAM30 | 0.73796 | reproduction GO:0000003 |
| 8 | A0A1B0GTY4 | TEX50 | 0.73573 | |
| 9 | Q9NRQ5 | SMCO4 | 0.72704 | |
| 10 | P22492 | H1-6 | 0.71507 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPE STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD....DD.................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDD.DDDD..D.............D...............................DD.D............................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD................................................................................ RICH_[K]: KKaKtKttKK RICH_[T]: TkTTkkrpqraT RICH_[KT]: KKaKTKTTKKrpqraT RICH_fLPS_[K]: mssKKaKtKttKKrpqrats RICH_MOBI_[K]: KKaKtKttKK RICH_MOBI_[T]: TkTTkkrpqraT RICH_MOBI_[KT]: KKaKTKTTKKrpqraT RICH_fLPS_MOBI_[K]: mssKKaKtKttKKrpqrats
120 140 160 AA: DVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD STMI: DO_DISOPRED3: ...................................................................DDDDD DO_IUPRED2A: ............................................D........................... DO_SPOTD: ..................................................................DDDDDD CONSENSUS: ...................................................................DDDDD CONSENSUS_MOBI: ........................................................................