A0A1B0GTY4 TEX50_HUMAN
Gene name: TEX50
Protein name: Testis-expressed protein 50
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NRQ5 | SMCO4 | 0.99414 | |
| 2 | P24844 | MYL9 | 0.97176 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 3 | Q9Y324 | FCF1 | 0.96235 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 4 | P42127 | ASIP | 0.96188 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q9Y291 | MRPS33 | 0.93676 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 6 | Q92963 | RIT1 | 0.93339 | signal transduction GO:0007165 |
| 7 | Q6NW29 | RWDD4 | 0.93311 | |
| 8 | Q9NWT1 | PAK1IP1 | 0.8983 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 ribosome biogenesis GO:0042254 ... |
| 9 | Q96A08 | H2BC1 | 0.8913 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 10 | Q494R4 | CCDC153 | 0.87991 |
20 40 60 80 100 AA: MSNQRLPLIFSLLFICFFGESFCICDGTVWTKVGWEILPEEVHYWKVKGSPSHCLPYLLDKLCCDFANMDIFQGCLYLIYNLLQAVFFVLFVLSVHYLWK STMI: SSSSSSSSSSSSSSSSSSSSSSS MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDD....................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDD............................................................................................... CONSENSUS: ................................................... ..... CONSENSUS_MOBI: ................................................... .....
120 140 160 AA: KWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY STMI: DO_DISOPRED3: ............DD..........................................DDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...........................................................DD.D............DD DO_SPOTD: .....DDDDDDDDDDDDDDDDDDDD...........................DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ............DD..........................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ......................................................DDDDDDDDDDDDDDDDDDDDDDD RICH_[K]: KKiKhcKlKKKsK RICH_fLPS_[K]: sKKiKhcKlKKKsKeegarr RICH_MOBI_[K]: KKiKhcKlKKKsK RICH_fLPS_MOBI_[K]: pssKKiKhcKlKKKsKeega