Q9NRQ5 SMCO4_HUMAN

Gene name: SMCO4
Protein name: Single-pass membrane and coiled-coil domain-containing protein 4

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A0A1B0GTY4 TEX50 0.99414
2 P24844 MYL9 0.99147 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
3 Q9Y324 FCF1 0.98357 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
4 P42127 ASIP 0.96737 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
5 Q92963 RIT1 0.95929 signal transduction GO:0007165
6 Q9Y291 MRPS33 0.95298 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
7 Q6NW29 RWDD4 0.95235
8 Q9NWT1 PAK1IP1 0.91777 anatomical structure development GO:0048856
cell population proliferation GO:0008283
ribosome biogenesis GO:0042254
...
9 Q96A08 H2BC1 0.9161 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
10 Q16363 LAMA4 0.89077 anatomical structure development GO:0048856
cell adhesion GO:0007155
embryo development GO:0009790
...

                                           20                  40 
AA:                      MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE
STMI:                                                   MMMMMMMMMMMMMMMMMMMMM       
DO_DISOPRED3:            DDDDDD.DD..DDDDD..........................................D
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDD....................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD...DDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD........                     ......D
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDD........                     .......
RICH_[K]:                    KgKpKKetsKdKKerK                                       
RICH_fLPS_[K]:           mrqlKgKpKKetsKdKKerK                                       
RICH_MOBI_[K]:               KgKpKKetsKdKKerK                                       
RICH_fLPS_MOBI_[K]:      mrqlKgKpKKetsKdKKerK