O15551 CLD3_HUMAN
Gene name: CLDN3
Protein name: Claudin-3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- homeostatic process GO:0042592
- response to stress GO:0006950
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NBJ9 | SIDT2 | 0.91915 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 2 | Q9BRY0 | SLC39A3 | 0.89443 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 embryo development GO:0009790 ... |
| 3 | Q03135 | CAV1 | 0.85749 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 4 | Q9NUV9 | GIMAP4 | 0.7935 | |
| 5 | Q13137 | CALCOCO2 | 0.77152 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 immune system process GO:0002376 ... |
| 6 | P52597 | HNRNPF | 0.60828 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 7 | Q8NE65 | ZNF738 | 0.58898 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 8 | P78396 | CCNA1 | 0.52945 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 9 | O43707 | ACTN4 | 0.50428 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 10 | P31943 | HNRNPH1 | 0.49679 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
20 40 60 80 100 AA: MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVG STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: D....... ................................................... CONSENSUS_MOBI: ........ ...................................................
120 140 160 180 200 AA: AQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSA STMI: M MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .........................................................................................DDDDDDDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: .......................................................................................DDDDDDDDDDDDD CONSENSUS: .............. ....................... .........DDDDDDDDDDD CONSENSUS_MOBI: .............. ....................... .................... RICH_[GY]: Ysa