Q03135 CAV1_HUMAN
Gene name: CAV1
Protein name: Caveolin-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- extracellular matrix organization GO:0030198
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- plasma membrane organization GO:0007009
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P20594 | NPR2 | 0.85749 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 2 | Q9UEU0 | VTI1B | 0.85749 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 3 | Q8NBJ9 | SIDT2 | 0.78816 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 4 | Q9BRY0 | SLC39A3 | 0.76696 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 embryo development GO:0009790 ... |
| 5 | Q9NUV9 | GIMAP4 | 0.68042 | |
| 6 | Q13137 | CALCOCO2 | 0.66157 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 immune system process GO:0002376 ... |
| 7 | P52597 | HNRNPF | 0.5216 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 8 | P98194 | ATP2C1 | 0.5145 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cytoskeleton organization GO:0007010 ... |
| 9 | Q8NE65 | ZNF738 | 0.50505 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 10 | P78396 | CCNA1 | 0.454 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
20 40 60 80 100 AA: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[GY]: GGkYvdseGhlYtvpireqG RICH_[IN]: IreqgNIykpNN
120 140 160 AA: RLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI STMI: IIIIIIIIIIIIIIIIIIIII DO_DISOPRED3: .............................................................................D DO_IUPRED2A: .............................................................................. DO_SPOTD: ............................................................................DD CONSENSUS: .... ....................................................D CONSENSUS_MOBI: .... .....................................................