Q9BRY0 S39A3_HUMAN
Gene name: SLC39A3
Protein name: Zinc transporter ZIP3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell morphogenesis GO:0000902
- embryo development GO:0009790
- homeostatic process GO:0042592
- immune system process GO:0002376
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UEU0 | VTI1B | 0.89443 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 2 | P20594 | NPR2 | 0.89443 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 3 | Q8NBJ9 | SIDT2 | 0.82211 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 4 | Q03135 | CAV1 | 0.76696 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 5 | Q9NUV9 | GIMAP4 | 0.70973 | |
| 6 | Q13137 | CALCOCO2 | 0.69007 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 immune system process GO:0002376 ... |
| 7 | P52597 | HNRNPF | 0.54406 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 8 | Q8NE65 | ZNF738 | 0.5268 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 9 | P78396 | CCNA1 | 0.47355 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 10 | O43707 | ACTN4 | 0.45104 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKLQKVLSLGHISTDYPLAETILLLGFFMTVF STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMM DO_DISOPRED3: .......DDDDDDDDDDDD.DDDDDDDDDDDD.DD................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: ... DDDDDD............ ...................... CONSENSUS_MOBI: ... .................. ......................
120 140 160 180 200 AA: LEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAHSVFEGLALGLQEEGEKVVSL STMI: MMMMMM MMMMMMMMMMMMMMMMMMMMM MMMM DO_DISOPRED3: .............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................... CONSENSUS: .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....... ...... CONSENSUS_MOBI: ............................................................... ...... RICH_[H]: HalyvepHgH RICH_[GY]: GsdseYespfmGGarGhalY
220 240 260 280 300 AA: FVGVAVHETLVAVALGISMARSAMPLRDAAKLAVTVSAMIPLGIGLGLGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLV STMI: MMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ............ ............ ......... CONSENSUS_MOBI: ............ ............ .........
AA: LGYTVLAGMVFLKW STMI: MMMMMMMMMMMMM DO_DISOPRED3: .............. DO_IUPRED2A: .............. DO_SPOTD: .............. CONSENSUS: . CONSENSUS_MOBI: .