O43482 MS18B_HUMAN
Gene name: OIP5
Protein name: Protein Mis18-beta
List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6NUT3 | MFSD12 | 0.65509 | biosynthetic process GO:0009058 transport GO:0006810 |
| 2 | O75388 | GPR32 | 0.63027 | homeostatic process GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
| 3 | Q86XL3 | ANKLE2 | 0.61099 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 4 | O94907 | DKK1 | 0.60898 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q6P582 | MZT2A | 0.6047 | |
| 6 | Q13258 | PTGDR | 0.59431 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 ... |
| 7 | Q96NS5 | ASB16 | 0.5928 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 8 | Q6NZ67 | MZT2B | 0.58806 | |
| 9 | Q8N100 | ATOH7 | 0.56372 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | O95672 | ECEL1 | 0.55726 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................... DO_IUPRED2A: D....DDDD......................D...........D.....DD..DDDDD.....D.................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: GssplGpAGlGAeepAAG RICH_[AP]: PlgPAglgAeePAAgP RICH_[A]: AglgAeepAA RICH_[C]: CatpprgdfC RICH_[R]: RhRsRcatppRgdfcggteR RICH_[T]: TeraidqasfTTsmewdT RICH_[CR]: RhRsRCatppRgdfCggteR RICH_[GP]: GssPlGPaGlGaeePaaGP
120 140 160 180 200 AA: LGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELK STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: EKIVLTHNRLKSLMKILSEVTPDQSKPEN STMI: DO_DISOPRED3: .....................DDDDDDDD DO_IUPRED2A: .......................DDDDDD DO_SPOTD: .....................DDDDDDDD CONSENSUS: .....................DDDDDDDD CONSENSUS_MOBI: .............................