O43678 NDUA2_HUMAN
Gene name: NDUFA2
Protein name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cellular component assembly GO:0022607
- embryo development GO:0009790
- generation of precursor metabolites and energy GO:0006091
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P0DMW3 | SMIM10L1 | 0.89278 | |
| 2 | Q8N4E7 | FTMT | 0.89168 | cell population proliferation GO:0008283 homeostatic process GO:0042592 transport GO:0006810 |
| 3 | Q9Y3B1 | PRELID3B | 0.87056 | transport GO:0006810 |
| 4 | P50440 | GATM | 0.8418 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 homeostatic process GO:0042592 ... |
| 5 | P28072 | PSMB6 | 0.84074 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 6 | P51817 | PRKX | 0.82865 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 7 | Q96I15 | SCLY | 0.82319 | small molecule metabolic process GO:0044281 |
| 8 | Q6L8Q7 | PDE12 | 0.81657 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cell death GO:0008219 ... |
| 9 | Q5VU92 | DCAF12L1 | 0.80782 | |
| 10 | Q9NPB0 | SAYSD1 | 0.79694 |
20 40 60 80 AA: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA STMI: DO_DISOPRED3: DDDDDDDDDD........................................................................................D DO_IUPRED2A: ................................................................................................... DO_SPOTD: DDDDDDDDDDDDD....................................................................................DD CONSENSUS: DDDDDDDDDD........................................................................................D CONSENSUS_MOBI: DDDDDDDDDDDDD...................................................................................... RICH_fLPS_[A]: mAAAAAsrgv RICH_MOBI_[A]: AAAAAsrgvgA RICH_fLPS_MOBI_[A]: AAAAAsrgvgA