O95997 PTTG1_HUMAN

Gene name: PTTG1
Protein name: Securin

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell division GO:0051301
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- DNA metabolic process GO:0006259
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- reproduction GO:0000003
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NZH5 PTTG2 0.67862 cell cycle GO:0007049
chromosome organization GO:0051276
chromosome segregation GO:0007059
...
2 Q86Z14 KLB 0.67165 carbohydrate metabolic process GO:0005975
cell population proliferation GO:0008283
cellular protein modification process GO:0006464
...
3 Q8NCM8 DYNC2H1 0.66908 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
4 O14950 MYL12B 0.6473 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
5 Q5TBB1 RNASEH2B 0.64559 anatomical structure development GO:0048856
catabolic process GO:0009056
cell cycle GO:0007049
...
6 Q86XJ1 GAS2L3 0.64409 cytoskeleton organization GO:0007010
7 Q96RR1 TWNK 0.64034 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
8 P24844 MYL9 0.63765 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
9 Q9UN37 VPS4A 0.6353 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
...
10 P22492 H1-6 0.63444 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ....DDDD...DD.DDDDDDDDDD....DDDDDDDDDDD...DDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AP]:                                                          PrfgktfdAPPAlPkAtrkA                                     
RICH_[K]:                                                                         KatrKalgtvnrateKsvKtKgplKqKqpsfsaKKmteKtvKa
RICH_[T]:                                                                           TrkalgTvnraTeksvkT                       
RICH_[KT]:                                                                        KaTrKalgTvnraTeKsvKTK                      
RICH_fLPS_[K]:                                                                                   KsvKtKgplKqKqpsfsaKKmteKtvKa
RICH_MOBI_[AF]:                                                       FgktFdAppAlpkAtrkA                                     
RICH_MOBI_[K]:                                                                    KatrKalgtvnrateKsvKtKgplKqKqpsfsaKKmteKtvKa
RICH_MOBI_[T]:                                                                      TrkalgTvnraTeksvkT                       
RICH_MOBI_[KT]:                                                                   KaTrKalgTvnraTeKsvKTK                      
RICH_fLPS_MOBI_[K]:                                                                              KsvKtKgplKqKqpsfsaKKmteKtvKa

                                          120                 140                 160                 180                 200
AA:                      KSSVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDI
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDD..........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
DO_IUPRED2A:             DDDDDD....................................................DDDDD..DD..DDDDDD..D......................
DO_SPOTD:                DDDDDDDDDD.........................................................................................D
CONSENSUS:               DDDDDDD..........................................................DDDDDDDDDDDDD......................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                K                                                                                                   
RICH_fLPS_[K]:           K                                                                                                   
RICH_MOBI_[F]:                           FFpFnpldFesF                                                                        
RICH_MOBI_[K]:           K                                                                                                   
RICH_MOBI_[L]:                                 LdfesfdLpeehqiahLpL    LmiLdeereLekLfqL                LLqspssiLstLdveL       
RICH_MOBI_[P]:                                                                         PPsPvkmPsPPwesnllqsP                  
RICH_MOBI_[CD]:                                                                                                   DvelppvCCDi
RICH_MOBI_[CI]:                                                                                              IlstldvelppvCCdI
RICH_MOBI_[CL]:                                                                                        LqspssiLstLdveLppvCC  
RICH_MOBI_[DI]:                                                                                                   DvelppvccDI
RICH_MOBI_[EF]:                      EiEkFFpFnpldFEsFdlpEE                                                                   
RICH_MOBI_[EL]:                                                LpLsgvpLmiLdEErELEkLfqL                                       
RICH_MOBI_[FL]:                                LdFesFdLpeehqiahLpL                                                           
RICH_MOBI_[HL]:                                       LpeeHqiaHLpL                                                           
RICH_MOBI_[IL]:                                       LpeehqIahLpLsgvpLmILdeereL                                             
RICH_MOBI_[LS]:                                                                                SppweSnLLqSpSSiLStL           
RICH_fLPS_MOBI_[P]:                                                                    PPsPvkmPsPP                           
RICH_fLPS_MOBI_[F]:              daypeiekFFpFnpldFesF                                                                        
RICH_fLPS_MOBI_[K]:      K                                                                                                   
RICH_fLPS_MOBI_[L]:                                            LpLsgvpLmiLdeereLekL                                          

                                           
AA:                      DI
STMI:                      
DO_DISOPRED3:            ..
DO_IUPRED2A:             ..
DO_SPOTD:                DD
CONSENSUS:               ..
CONSENSUS_MOBI:          DD
RICH_MOBI_[CD]:          D 
RICH_MOBI_[CI]:          dI
RICH_MOBI_[DI]:          DI