P24844 MYL9_HUMAN
Gene name: MYL9
Protein name: Myosin regulatory light polypeptide 9
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- immune system process GO:0002376
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y324 | FCF1 | 0.99563 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 2 | Q9NRQ5 | SMCO4 | 0.99147 | |
| 3 | Q92963 | RIT1 | 0.97913 | signal transduction GO:0007165 |
| 4 | A0A1B0GTY4 | TEX50 | 0.97176 | |
| 5 | Q6NW29 | RWDD4 | 0.96102 | |
| 6 | P42127 | ASIP | 0.95766 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q9Y291 | MRPS33 | 0.9574 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 8 | Q96A08 | H2BC1 | 0.93105 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 9 | Q9NWT1 | PAK1IP1 | 0.9261 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 ribosome biogenesis GO:0042254 ... |
| 10 | Q16363 | LAMA4 | 0.91556 | anatomical structure development GO:0048856 cell adhesion GO:0007155 embryo development GO:0009790 ... |
20 40 60 80 100 AA: MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPE STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.....D.................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDD..DDD..D.............D..............................DDDDDDDD......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD................................................................................ RICH_[K]: KraKaKttKK RICH_fLPS_[K]: KraKaKttKK RICH_MOBI_[K]: KraKaKttKK RICH_fLPS_MOBI_[K]: KraKaKttKK
120 140 160 AA: DVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD STMI: DO_DISOPRED3: ...................................................................DDDDD DO_IUPRED2A: ....................................DDD.DDD.D........................... DO_SPOTD: ..................................................................DDDDDD CONSENSUS: ...................................................................DDDDD CONSENSUS_MOBI: ........................................................................