P01137 TGFB1_HUMAN
Gene name: TGFB1
Protein name: Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell division GO:0051301
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- DNA metabolic process GO:0006259
- embryo development GO:0009790
- extracellular matrix organization GO:0030198
- growth GO:0040007
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q2TAA8 | TSNAXIP1 | 1 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
2 | Q96RQ3 | MCCC1 | 1 |
catabolic process
GO:0009056 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
3 | Q9UI26 | IPO11 | 0.99941 |
nucleocytoplasmic transport
GO:0006913 protein transport GO:0015031 transport GO:0006810 |
4 | P42857 | NSG1 | 0.99746 |
cell death
GO:0008219 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
5 | Q07817 | BCL2L1 | 0.99388 |
anatomical structure development
GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
6 | Q86XI2 | NCAPG2 | 0.98995 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
7 | Q9BTA0 | FAM167B | 0.98058 | |
8 | Q8NEV9 | IL27 | 0.97823 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
9 | Q9GZL7 | WDR12 | 0.95506 |
cell cycle
GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
10 | P36575 | ARR3 | 0.93405 |
cellular protein modification process
GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 ... |
20 40 60 80 100
AA: MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPE
STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSSSS
DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................DDDDDDDDDDDD
DO_IUPRED2A: .............................................................D.DDDDDDD.................DDDDDDDDDDDDD
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................DDDDDDDDDDDDDD
CONSENSUS: DDDDDD....................................................DDDDDDDDDDDDD
CONSENSUS_MOBI: ..............................................................DDDDD....
RICH_[E]: EsaEpEpEpE
RICH_fLPS_[E]: EsaEpEpEpE
120 140 160 180 200
AA: ADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDV
STMI:
DO_DISOPRED3: DDDDD.................DDD...........................................................................
DO_IUPRED2A: D...................................................................................................
DO_SPOTD: DD..................................................................................................
CONSENSUS: DD..................................................................................................
CONSENSUS_MOBI: ....................................................................................................
220 240 260 280 300
AA: TGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
STMI:
DO_DISOPRED3: ...................................DDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDDDDD..............
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: ...................................................................DDDDDDDDDDDDDDDDDDDDDD...........
CONSENSUS: ...................................................................DDDDDDDDDDDDDDDDDDD..............
CONSENSUS_MOBI: ..........................................................................DDDD......................
320 340 360 380
AA: DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
STMI:
DO_DISOPRED3: ..........................................................................................
DO_IUPRED2A: ..........................................................................................
DO_SPOTD: ..........................................................................................
CONSENSUS: ..........................................................................................
CONSENSUS_MOBI: ..........................................................................................