Q9BTA0 F167B_HUMAN
Gene name: FAM167B
Protein name: Protein FAM167B
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NEV9 | IL27 | 0.99993 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 2 | Q86XI2 | NCAPG2 | 0.99846 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 3 | Q07817 | BCL2L1 | 0.99624 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 4 | P42857 | NSG1 | 0.99206 | cell death GO:0008219 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
| 5 | Q9UI26 | IPO11 | 0.98676 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 6 | P55064 | AQP5 | 0.98058 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ... |
| 7 | Q5MCW4 | ZNF569 | 0.98058 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q9UKJ5 | CHIC2 | 0.98058 | |
| 9 | Q8NBI5 | SLC43A3 | 0.94937 | |
| 10 | P36575 | ARR3 | 0.89984 | cellular protein modification process GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MSLGLLKFQAVGEEDEEDEEGESLDSVKALTAKLQLQTRRPSYLEWTAQVQSQAWRRAQAKPGPGGPGDICGFDSMDSALEWLRRELREMQAQDRQLAGQ STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD....................................DDDDDDDDDD.................................. DO_IUPRED2A: ...........DDDDDDDDDDDDDD.............................DDDDDDDD..DDDDDDD............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDD..........................DD.D CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD...............................DDDDDDDDDDDDDDDD.............................. CONSENSUS_MOBI: .................................................................................................... RICH_[E]: EEdEEdEEgE RICH_fLPS_[E]: fqavgEEdEEdEEgE
120 140 160 AA: LLRLRAQLHRLKMDQACHLHQELLDEAELELELEPGAGLALAPLLRHLGLTRMNISARRFTLC STMI: DO_DISOPRED3: ............................................................... DO_IUPRED2A: ............................................................... DO_SPOTD: DD.D......................DDDD.D.D............................. CONSENSUS: ............................................................... CONSENSUS_MOBI: ...............................................................