P42857 NSG1_HUMAN
Gene name: NSG1
Protein name: Neuronal vesicle trafficking-associated protein 1
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UI26 | IPO11 | 0.99932 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 2 | Q07817 | BCL2L1 | 0.99923 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 3 | Q86XI2 | NCAPG2 | 0.99751 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 4 | Q5MCW4 | ZNF569 | 0.99746 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q9UKJ5 | CHIC2 | 0.99746 | |
| 6 | P01137 | TGFB1 | 0.99746 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 7 | Q9BTA0 | FAM167B | 0.99206 | |
| 8 | Q8NEV9 | IL27 | 0.99053 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 9 | Q8NBI5 | SLC43A3 | 0.94293 | |
| 10 | Q96M32 | AK7 | 0.93152 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGKARPPQIAEFTVSITEGVTERFKVSVLVLFALAFLTCVVFL STMI: MMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD.........................................DDDDDDDD............................... DO_IUPRED2A: ................................................DD...DDDDDDD........................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD..DD.D..D.D.D...DD..DDDDDDDDDDDDDDDDDDD.................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDD............................DDDDDDDDDDDDDDDDDD................ CONSENSUS_MOBI: ..................................................................................
120 140 160 180 AA: VVYKVYKYDRACPDGFVLKNTQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA STMI: MMM DO_DISOPRED3: .....................................................................DDDDDDDDDDDDDDDD DO_IUPRED2A: ..............................................................................DDD..DD DO_SPOTD: .......................................................DDDDDDDD...DDDDDDDDDDDDDDDDDDD CONSENSUS: ..................................................................DDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................. RICH_[E]: EEklsEqEtEaaE RICH_fLPS_[E]: EEklsEqEtEaaEks