Q07817 B2CL1_HUMAN

Gene name: BCL2L1
Protein name: Bcl-2-like protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell division GO:0051301
- cell population proliferation GO:0008283
- embryo development GO:0009790
- growth GO:0040007
- immune system process GO:0002376
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86XI2 NCAPG2 0.99951 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
2 P42857 NSG1 0.99923 cell death GO:0008219
cell-cell signaling GO:0007267
cellular component assembly GO:0022607
...
3 Q9UI26 IPO11 0.9971 nucleocytoplasmic transport GO:0006913
protein transport GO:0015031
transport GO:0006810
4 Q13049 TRIM32 0.99624 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
5 Q9BTA0 FAM167B 0.99624
6 Q8NEV9 IL27 0.99517 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
7 Q9UKJ5 CHIC2 0.99388
8 Q96RQ3 MCCC1 0.99388 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
9 Q8NBI5 SLC43A3 0.94656
10 P36575 ARR3 0.91929 cellular protein modification process GO:0006464
nervous system process GO:0050877
signal transduction GO:0007165
...

                                           20                  40                  60                  80                 100
AA:                      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDD...DDDD.....DDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDD....DD....DDDDDDDDDDDDDDD.....................
DO_IUPRED2A:             D..........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDD...DDD.D............................
DO_SPOTD:                DD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS:               DD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[E]:                                              EEnrtEapEgtEsEmE                                                      
RICH_fLPS_[E]:                                      sdvEEnrtEapEgtEsEmEt                                                     

                                          120                 140                 160                 180                 200
AA:                      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          220       
AA:                      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
STMI:                             MMMMMMMMMMMMMMMMM       
DO_DISOPRED3:            .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .................................
DO_SPOTD:                .................................
CONSENSUS:               .........                 .......
CONSENSUS_MOBI:          .........                 .......