P04808 REL1_HUMAN
Gene name: RLN1
Protein name: Prorelaxin H1 [Cleaved into: Relaxin B chain; Relaxin A chain]
List of terms from Generic GO subset, which this protein is a part of:
- reproduction GO:0000003
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y6R6 | ZNF780B | 0.8 | |
| 2 | Q13557 | CAMK2D | 0.78632 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | P37173 | TGFBR2 | 0.70711 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 4 | Q9H3R1 | NDST4 | 0.66742 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 5 | P49910 | ZNF165 | 0.63849 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q6UXV0 | GFRAL | 0.63312 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 7 | P42574 | CASP3 | 0.61874 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 8 | P49116 | NR2C2 | 0.60663 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | Q86UQ5 | GTSCR1 | 0.59136 | |
| 10 | Q96EC8 | YIPF6 | 0.56489 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKA STMI: SSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDD........DD..... DO_IUPRED2A: ........................................................DDDDD.DDD................................... DO_SPOTD: DDDDDDDDDDDDDDDD..DD................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............. CONSENSUS: ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD............... CONSENSUS_MOBI: .............................................................................. RICH_[I]: IvpsfInkdtetII
120 140 160 180 AA: ALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC STMI: DO_DISOPRED3: .............................DD...DDDDDDDDDDDDDDDDDDDDDD............................. DO_IUPRED2A: ....................................D.............DDD................................ DO_SPOTD: DDDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................... CONSENSUS: ..................................DDDDDDDDDDDDDDDDDDDDDD............................. CONSENSUS_MOBI: .....................................................................................