P05204 HMGN2_HUMAN

Gene name: HMGN2
Protein name: Non-histone chromosomal protein HMG-17

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O00479 HMGN4 0.91225
2 Q6DN03 H2BC20P 0.83452 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
3 Q6DRA6 H2BC19P 0.83238 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
4 P07305 H1-0 0.81957 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
5 O75367 MACROH2A1 0.8169 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 O60814 H2BC12 0.80742 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
7 Q16778 H2BC21 0.80736 cellular component assembly GO:0022607
chromosome organization GO:0051276
immune system process GO:0002376
...
8 Q8IZA3 H1-8 0.80707 biosynthetic process GO:0009058
cell cycle GO:0007049
cell differentiation GO:0030154
...
9 P23527 H2BC17 0.80134 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
10 P62807 H2BC4 0.8011 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...

                                           20                  40                  60                  80          
AA:                      MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
STMI:                                                                                                              
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AG]:                                                          ApAkkGekvpkGkkGkAdAG                           
RICH_[AK]:                            KAKvKdepqrrsArlsAKpA         KApAKKgeKvpKgKKgKAdA                            
RICH_[AP]:                                        ArlsAkPAPPkPePkPkkAPA                                            
RICH_[A]:                                                                                     AengdAktdqAqkAegAgdA 
RICH_[K]:                  KrKaegdaKgdKaKvKdepqrrsarlsaKpappKpepKpKKapaKKgeKvpKgKKgKadagKegnnpaengdaK              
RICH_[P]:                                    PqrrsarlsakPaPPkPePkPkkaPakkgekvP                                     
RICH_[DK]:                   KaegDaKgDKaKvKD                                                                       
RICH_[GK]:                                                             KKGeKvpKGKKGKadaGKeGnnpaenGdaK              
RICH_[KP]:                                             KPaPPKPePKPKKaPaKKgeKvPKgKK                                 
RICH_fLPS_[P]:                                         kPaPPkPePkPkkaP                                             
RICH_fLPS_[KP]:                                        KPaPPKPePKPKKaPaKKgeKvPKgKKgK                               
RICH_fLPS_[K]:           mpKrKaegdaKgdKaKvKde          KpappKpepKpKKapaKKgeKvpKgKKgKadagK                          
RICH_MOBI_[AG]:                                                     ApAkkGekvpkGkkGkAdAG                           
RICH_MOBI_[AK]:                       KAKvKdepqrrsArlsAKpA         KApAKKgeKvpKgKKgKAdA                            
RICH_MOBI_[AP]:                                   ArlsAkPAPPkPePkPkkAPA                                            
RICH_MOBI_[A]:                                                                                AengdAktdqAqkAegAgdA 
RICH_MOBI_[K]:             KrKaegdaKgdKaKvKdepqrrsarlsaKpappKpepKpKKapaKKgeKvpKgKKgKadagKegnnpaengdaK              
RICH_MOBI_[P]:                               PqrrsarlsakPaPPkPePkPkkaPakkgekvP                                     
RICH_MOBI_[DK]:              KaegDaKgDKaKvKD                                                                       
RICH_MOBI_[GK]:                                                        KKGeKvpKGKKGKadaGKeGnnpaenGdaK              
RICH_MOBI_[KP]:                                        KPaPPKPePKPKKaPaKKgeKvPK                                    
RICH_fLPS_MOBI_[P]:                                    kPaPPkPePkPkkaP                                             
RICH_fLPS_MOBI_[KP]:                                   KPaPPKPePKPKKaPaKKgeKvPKgKKgK                               
RICH_fLPS_MOBI_[K]:      mpKrKaegdaKgdKaKvKde          KpappKpepKpKKapaKKgeKvpKgKKgKadagK