O60814 H2B1K_HUMAN

Gene name: H2BC12
Protein name: Histone H2B type 1-K

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P62807 H2BC4 0.99803 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
2 Q16778 H2BC21 0.99564 cellular component assembly GO:0022607
chromosome organization GO:0051276
immune system process GO:0002376
...
3 P23527 H2BC17 0.98343 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
4 Q93079 H2BC9 0.98332 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
5 Q5QNW6 H2BC18 0.95635 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
6 P33778 H2BC3 0.9489 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
7 P57053 H2BS1 0.94829 anatomical structure development GO:0048856
cellular component assembly GO:0022607
chromosome organization GO:0051276
...
8 P07305 H1-0 0.94401 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
9 Q99877 H2BC15 0.93413 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
10 Q8N257 H2BU1 0.92211 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003

                                           20                  40                  60                  80                 100
AA:                      MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDD.D..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................
RICH_[AK]:                   AKsApApKKgsKKAvtKAqKK                                                                           
RICH_[AP]:                PePAksAPAPkkgskkA                                                                                  
RICH_[K]:                     KsapapKKgsKKavtKaqKKdgKKrK                                                                     
RICH_[KP]:                PePaKsaPaPKKgsKKavtK                                                                               
RICH_[KR]:                                       KdgKKRKRsR                                                                  
RICH_fLPS_[K]:                      KKgsKKavtKaqKKdgKKrK                                                                     
RICH_MOBI_[AK]:              AKsApApKKgsKKAvtKAqKK                                                                           
RICH_MOBI_[AP]:           PePAksAPAP                                                                                         
RICH_MOBI_[K]:                KsapapKKgsKKavtKaqKKdgKK                                                                       
RICH_fLPS_MOBI_[K]:           KsapapKKgsKKavtKaqKKdgKK                                                                       

                                          120              
AA:                      LLLPGELAKHAVSEGTKAVTKYTSAK
STMI:                                              
DO_DISOPRED3:            .........................D
DO_IUPRED2A:             ..........................
DO_SPOTD:                .................DDDDDDDDD
CONSENSUS:               .........................D
CONSENSUS_MOBI:          ..........................